BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J18 (406 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g42850.1 68416.m04489 galactokinase, putative contains some s... 27 6.3 At1g60440.1 68414.m06804 eukaryotic pantothenate kinase family p... 26 8.3 >At3g42850.1 68416.m04489 galactokinase, putative contains some similarity to galactokinase [Pasteurella multocida] SWISS-PROT:P57899 Length = 964 Score = 26.6 bits (56), Expect = 6.3 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 1 SDGHSDHVVIANPDSFFFQPLNGPNV 78 S GH HVV A P+ F ++ PN+ Sbjct: 40 SSGHRVHVVSAAPEFVFTMEIHSPNL 65 >At1g60440.1 68414.m06804 eukaryotic pantothenate kinase family protein similar to pantothenate kinase GI:4191500 from [Aspergillus nidulans]; contains Pfam profile PF03630: Fumble Length = 383 Score = 26.2 bits (55), Expect = 8.3 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 272 KCITKLKSLGKYYKINHHFSSLTIRLSL*DIY 177 K +TK KS + +++HH ++ I + + DIY Sbjct: 189 KLLTKCKSFDELLELSHHGNNRVIDMLVGDIY 220 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,303,218 Number of Sequences: 28952 Number of extensions: 151751 Number of successful extensions: 244 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 244 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 595686720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -