BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J17 (268 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0319 + 2503963-2504176,2504316-2504376,2504691-2504769,250... 29 0.67 07_03_0105 + 13455906-13457198 28 1.2 09_04_0078 + 14379720-14379786,14379903-14379974,14381093-143814... 27 2.1 02_03_0200 - 16282220-16282255,16283662-16284126,16284491-16284595 27 2.1 10_08_0295 - 16581014-16583071 26 3.6 08_02_0830 - 21617485-21618198 26 3.6 05_05_0253 - 23632907-23633646,23633758-23635050,23636471-23636663 26 3.6 03_05_0252 - 22403504-22404676 26 3.6 01_06_0486 - 29729333-29729356,29729856-29730106,29730364-297304... 26 3.6 06_03_0065 - 16135582-16136001,16136308-16136376 26 4.8 04_04_1032 - 30259180-30260519,30260650-30260720,30261099-302621... 26 4.8 03_01_0608 + 4471738-4472115 26 4.8 02_04_0253 + 21310082-21310094,21310606-21311135 26 4.8 02_04_0249 + 21283004-21283016,21283526-21284055 26 4.8 02_04_0247 + 21273978-21273990,21274500-21275029 26 4.8 02_04_0245 + 21262645-21262754,21262851-21262997,21263100-212631... 26 4.8 01_05_0597 - 23526705-23526749,23526794-23526905,23527068-235271... 26 4.8 11_01_0031 + 248264-248513,248519-249007,249178-249445,249631-24... 25 6.3 10_03_0046 + 7357777-7357992 25 6.3 07_03_0730 + 21030123-21030338 25 6.3 06_03_0729 + 23927656-23927661,23927774-23927923,23928316-239285... 25 6.3 01_06_1064 + 34237919-34238155 25 6.3 01_05_0006 + 17008799-17009417,17010035-17010162,17010425-170106... 25 6.3 04_03_0558 + 17111138-17111996,17112474-17112564,17112647-171132... 25 8.3 03_05_0611 + 26113798-26114261,26114451-26114597,26114784-26115405 25 8.3 03_02_0182 - 6216991-6217238,6218076-6218197,6218412-6218497,621... 25 8.3 >05_01_0319 + 2503963-2504176,2504316-2504376,2504691-2504769, 2504861-2504940,2505046-2505140,2505748-2505847, 2506647-2506716,2507657-2507758,2507972-2508053, 2508257-2508304,2508841-2509009,2509089-2509314, 2509961-2510131,2510200-2510438,2510600-2510684, 2510778-2510876,2510954-2511153,2511232-2511307, 2511463-2511675,2511763-2511815,2511999-2512151, 2512474-2512606 Length = 915 Score = 28.7 bits (61), Expect = 0.67 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 68 RWWRL-PALTPPEHRLARASTDPGTLLMFR 154 RW RL PA PP R A A+ GT+++F+ Sbjct: 89 RWTRLHPAGEPPSPRAAHAAAAVGTMVVFQ 118 >07_03_0105 + 13455906-13457198 Length = 430 Score = 27.9 bits (59), Expect = 1.2 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -2 Query: 183 CSDGVRRWYCLNISSVPGSVEARARRCSGGVSAG 82 CS RRW L P ++A RC GG G Sbjct: 71 CSQNARRWSRLVGLHQPSGLDAETCRCVGGTRDG 104 >09_04_0078 + 14379720-14379786,14379903-14379974,14381093-14381497, 14382835-14382911,14383016-14383135,14383227-14383997, 14384933-14385146,14385269-14385735 Length = 730 Score = 27.1 bits (57), Expect = 2.1 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 5/36 (13%) Frame = -2 Query: 168 RRWYCLNISSVPGSVEAR-----ARRCSGGVSAGKR 76 RRW L I SVPG+ R RC+ GV G+R Sbjct: 89 RRWVGLEIDSVPGNEGQRDIVNYYLRCATGVGNGER 124 >02_03_0200 - 16282220-16282255,16283662-16284126,16284491-16284595 Length = 201 Score = 27.1 bits (57), Expect = 2.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 132 GSVEARARRCSGGVSAGKRHHRCN 61 G+VEA+ +GG G+ HHR N Sbjct: 135 GAVEAKKGGAAGGGDDGRHHHRHN 158 >10_08_0295 - 16581014-16583071 Length = 685 Score = 26.2 bits (55), Expect = 3.6 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -2 Query: 264 DAGHFVFGCFAADNHVNGMTSFYRADSCSDGVRRWYCLNISSVPG 130 D G F ++AD HV+ ++R C +G+ + Y N + + G Sbjct: 100 DGGRFTITPWSADRHVHHPNWWFRVRLCLEGLPQ-YAWNRAGLEG 143 >08_02_0830 - 21617485-21618198 Length = 237 Score = 26.2 bits (55), Expect = 3.6 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -2 Query: 195 RADSCSDGVRRWYCLNISSVPGSVEARARRCSGGVSAGK 79 RADSC RW GS + + R GG+S G+ Sbjct: 90 RADSCE----RWDAHKNKKAGGSAASSSSRARGGISPGR 124 >05_05_0253 - 23632907-23633646,23633758-23635050,23636471-23636663 Length = 741 Score = 26.2 bits (55), Expect = 3.6 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -2 Query: 264 DAGHFVFGCFAADNHVNGMTSFYRADSCSDGVRRWYCLNISSVPG 130 D G F ++AD HV+ ++R C +G+ + Y N + + G Sbjct: 450 DGGRFTITPWSADRHVHHPNWWFRVRLCLEGLPQ-YAWNRAGLEG 493 >03_05_0252 - 22403504-22404676 Length = 390 Score = 26.2 bits (55), Expect = 3.6 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +3 Query: 69 GGGAYQRLPHRSTA*RVLRLIPARC*CSDSTSALHH---HYSCQLGKSWSFH 215 GGG + R R+ R+L C + AL Y CQLG++ +FH Sbjct: 41 GGGDFGRAVARAAVARMLEAAGFVCAHRSAVDALVDVLLRYICQLGRAATFH 92 >01_06_0486 - 29729333-29729356,29729856-29730106,29730364-29730466, 29730571-29730663,29730773-29730905,29731184-29731272, 29731385-29731553,29731930-29732016,29732388-29732506, 29732554-29732706 Length = 406 Score = 26.2 bits (55), Expect = 3.6 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = -2 Query: 201 FYRADSCSDGVRRWYCLNISSVPGSVEARARRCSG 97 F+ + +G R +YC + + G R R C G Sbjct: 319 FFCSKCGQEGHRSFYCPTVREISGRAHFRCRLCGG 353 >06_03_0065 - 16135582-16136001,16136308-16136376 Length = 162 Score = 25.8 bits (54), Expect = 4.8 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -2 Query: 189 DSCSDGVRRWYCLNISSVPGSVEARARRCSGGVSAGKR 76 ++CS G RW I + EA R GG G+R Sbjct: 84 ENCSSGKDRWKVFLIHVGGSTGEALGRGAHGGARPGRR 121 >04_04_1032 - 30259180-30260519,30260650-30260720,30261099-30262118, 30263886-30264121 Length = 888 Score = 25.8 bits (54), Expect = 4.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 144 SSVPGSVEARARRCSGGVSAGKRHHR 67 +S GS ++ R +S GKRHHR Sbjct: 800 NSKKGSSSSQKVRALSSISIGKRHHR 825 >03_01_0608 + 4471738-4472115 Length = 125 Score = 25.8 bits (54), Expect = 4.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 189 DSCSDGVRRWYCLNISSVPGSVEARARRC 103 D+C+D R C+N VP + +RC Sbjct: 85 DACADACARTVCVNQHQVPNWNDVCLKRC 113 >02_04_0253 + 21310082-21310094,21310606-21311135 Length = 180 Score = 25.8 bits (54), Expect = 4.8 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = -2 Query: 195 RADSCSDGVRRWYCLNISSVPGSVEARARRCSGGVS 88 R D D R++ + +PG V RRC S Sbjct: 6 RTDVDEDAARKYVLEKVDELPGEVADMVRRCDAASS 41 >02_04_0249 + 21283004-21283016,21283526-21284055 Length = 180 Score = 25.8 bits (54), Expect = 4.8 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = -2 Query: 195 RADSCSDGVRRWYCLNISSVPGSVEARARRCSGGVS 88 R D D R++ + +PG V RRC S Sbjct: 6 RTDVDEDAARKYVLEKVDELPGEVADMVRRCDAASS 41 >02_04_0247 + 21273978-21273990,21274500-21275029 Length = 180 Score = 25.8 bits (54), Expect = 4.8 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = -2 Query: 195 RADSCSDGVRRWYCLNISSVPGSVEARARRCSGGVS 88 R D D R++ + +PG V RRC S Sbjct: 6 RTDVDEDAARKYVLEKVDELPGEVADMVRRCDAASS 41 >02_04_0245 + 21262645-21262754,21262851-21262997,21263100-21263156, 21263256-21263442,21264700-21264925,21265474-21266003 Length = 418 Score = 25.8 bits (54), Expect = 4.8 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = -2 Query: 195 RADSCSDGVRRWYCLNISSVPGSVEARARRCSGGVS 88 R D D R++ + +PG V RRC S Sbjct: 244 RTDVDEDAARKYVLEKVDELPGEVADMVRRCDAASS 279 >01_05_0597 - 23526705-23526749,23526794-23526905,23527068-23527134, 23527439-23527566,23527638-23527750,23527827-23527972, 23528419-23528525,23528667-23528873,23530878-23531129, 23531324-23531406 Length = 419 Score = 25.8 bits (54), Expect = 4.8 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 165 RWYCLNISSVPGSVEARARRCSGGVSAG 82 RW + VP + E R RC+ VS+G Sbjct: 65 RWEKGSTRRVPAASERRVERCAAAVSSG 92 >11_01_0031 + 248264-248513,248519-249007,249178-249445,249631-249718 Length = 364 Score = 25.4 bits (53), Expect = 6.3 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 42 CHLRSSSCIGGGAYQRL 92 C +++CIGGGA+ R+ Sbjct: 216 CAANNATCIGGGAFARI 232 >10_03_0046 + 7357777-7357992 Length = 71 Score = 25.4 bits (53), Expect = 6.3 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -2 Query: 189 DSCSDGVRRWYCLNISSVPGSVEARARRCSGGVSAGK 79 D DG+RRW+C S S E + R GG G+ Sbjct: 23 DGGGDGLRRWWCRPASG--RSTERVSGREVGGFGGGE 57 >07_03_0730 + 21030123-21030338 Length = 71 Score = 25.4 bits (53), Expect = 6.3 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -2 Query: 189 DSCSDGVRRWYCLNISSVPGSVEARARRCSGGVSAGK 79 D DG+RRW+C S S E + R GG G+ Sbjct: 23 DGGGDGLRRWWCRPASG--RSTERVSGREVGGFGGGE 57 >06_03_0729 + 23927656-23927661,23927774-23927923,23928316-23928567, 23929072-23929209,23931213-23932730 Length = 687 Score = 25.4 bits (53), Expect = 6.3 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 83 PALTPPEHRLARASTDPGTLL 145 PAL PPE R+ A D TLL Sbjct: 430 PALGPPEVRVTGAGADRDTLL 450 >01_06_1064 + 34237919-34238155 Length = 78 Score = 25.4 bits (53), Expect = 6.3 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -2 Query: 189 DSCSDGVRRWYCLNISSVPGSVEARARRCSGGVSAGK 79 D DG+RRW+C S S E + R GG G+ Sbjct: 23 DGGGDGLRRWWCRPASG--RSTERVSGREVGGFGGGE 57 >01_05_0006 + 17008799-17009417,17010035-17010162,17010425-17010650, 17010792-17010925,17010988-17011161,17011234-17012238 Length = 761 Score = 25.4 bits (53), Expect = 6.3 Identities = 12/47 (25%), Positives = 22/47 (46%) Frame = +3 Query: 117 VLRLIPARC*CSDSTSALHHHYSCQLGKSWSFH*RGYQRQNTRRQNG 257 ++ + P RC S+ + + +C +G S H R+N + NG Sbjct: 579 LIEMYPDRCGNSEQSPDVPEALTCLMGSSDEIHELETMRRNCKHLNG 625 >04_03_0558 + 17111138-17111996,17112474-17112564,17112647-17113268, 17113378-17113457,17113871-17113937,17114138-17114263, 17114333-17114415,17115334-17115777,17115834-17115927, 17116038-17116124,17116474-17116594,17116671-17116709, 17116828-17116997 Length = 960 Score = 25.0 bits (52), Expect = 8.3 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 106 PPSACFD*SRHAADVQTVPAPYTITTAVSSVK 201 P C +R + +P P T+TTA+ ++K Sbjct: 125 PEQPCTPPARSERQILRLPPPATVTTAIVALK 156 >03_05_0611 + 26113798-26114261,26114451-26114597,26114784-26115405 Length = 410 Score = 25.0 bits (52), Expect = 8.3 Identities = 11/21 (52%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +2 Query: 68 RWW-RLPALTPPEHRLARAST 127 RWW RLP PP + R ST Sbjct: 118 RWWARLPPRPPPREDMERWST 138 >03_02_0182 - 6216991-6217238,6218076-6218197,6218412-6218497, 6219105-6219218 Length = 189 Score = 25.0 bits (52), Expect = 8.3 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 111 RRCSGGVSAGKRHHRCNCYYVSD 43 RR G SAG+RH RC ++D Sbjct: 56 RRSYWGFSAGERHVRCRPMVLAD 78 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,391,244 Number of Sequences: 37544 Number of extensions: 160025 Number of successful extensions: 446 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 14,793,348 effective HSP length: 67 effective length of database: 12,277,900 effective search space used: 257835900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -