BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J17 (268 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase f... 28 0.74 At4g03080.1 68417.m00416 kelch repeat-containing serine/threonin... 27 1.3 At5g52550.1 68418.m06525 expressed protein 26 3.0 At2g19920.1 68415.m06036 RNA-dependent RNA polymerase family pro... 26 3.0 At5g01130.1 68418.m00017 hypothetical protein contains Pfam prof... 25 5.2 At4g14800.1 68417.m02275 20S proteasome beta subunit D2 (PBD2) (... 25 5.2 At3g22630.1 68416.m02857 20S proteasome beta subunit D (PBD1) (P... 25 5.2 At2g33580.1 68415.m04115 protein kinase family protein / peptido... 25 5.2 At2g24640.1 68415.m02943 ubiquitin carboxyl-terminal hydrolase f... 25 5.2 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 25 5.2 At1g34550.1 68414.m04294 expressed protein contains Pfam profile... 25 5.2 At5g37470.1 68418.m04509 hypothetical protein contains Pfam PF04... 25 6.9 At1g72310.1 68414.m08359 zinc finger (C3HC4-type RING finger) fa... 25 6.9 At5g64816.2 68418.m08154 expressed protein 25 9.1 At5g64816.1 68418.m08153 expressed protein 25 9.1 At5g52050.1 68418.m06460 MATE efflux protein-related contains Pf... 25 9.1 At5g51930.1 68418.m06442 glucose-methanol-choline (GMC) oxidored... 25 9.1 At5g10080.1 68418.m01168 aspartyl protease family protein contai... 25 9.1 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 25 9.1 >At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 15 (UBP15) [Arabidopsis thaliana] GI:11993475; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 631 Score = 28.3 bits (60), Expect = 0.74 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -2 Query: 237 FAADNHVNGMTSFYRADSCSDGVRRWYCLNISSVPGSVEARARRCSGG 94 F A+ ++G + Y+ D CSD V+ L I P + +R GG Sbjct: 337 FTAEEWLHG-DNMYKCDRCSDYVKACKRLTIRRAPNILTIALKRYQGG 383 >At4g03080.1 68417.m00416 kelch repeat-containing serine/threonine phosphoesterase family protein contains Pfam profiles: PF00149 calcineurin-like phosphoesterase, PF01344 kelch motif Length = 881 Score = 27.5 bits (58), Expect = 1.3 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 68 RWWRL-PALTPPEHRLARASTDPGTLLMFR 154 +W RL PA PP R A A+ GT+++F+ Sbjct: 85 KWTRLKPAGEPPSPRAAHAAAAVGTMVVFQ 114 >At5g52550.1 68418.m06525 expressed protein Length = 360 Score = 26.2 bits (55), Expect = 3.0 Identities = 13/49 (26%), Positives = 18/49 (36%) Frame = -2 Query: 189 DSCSDGVRRWYCLNISSVPGSVEARARRCSGGVSAGKRHHRCNCYYVSD 43 + C D R P + SGG++ H RC+ Y V D Sbjct: 250 EDCDDSYRNTLNQETGFKPWDYTTKINLFSGGINRFFPHQRCSSYAVHD 298 >At2g19920.1 68415.m06036 RNA-dependent RNA polymerase family protein contains Pfam domain, PF05183: RNA dependent RNA polymerase Length = 927 Score = 26.2 bits (55), Expect = 3.0 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 153 DSTSALHHHYSCQLGKSWSFH*RGYQRQNT 242 +S S H+Y C + S+ +GY +NT Sbjct: 207 ESDSGKTHYYQCHVAPDGSYRLKGYFLENT 236 >At5g01130.1 68418.m00017 hypothetical protein contains Pfam profile PF05056: Protein of unknown function (DUF674) Length = 484 Score = 25.4 bits (53), Expect = 5.2 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 150 SDSTSALHHHYSCQ 191 S S SA+HH Y+CQ Sbjct: 319 STSKSAIHHFYTCQ 332 >At4g14800.1 68417.m02275 20S proteasome beta subunit D2 (PBD2) (PRCGA) identical to SP|O24633 Proteasome subunit beta type 2-2 (EC 3.4.25.1) (20S proteasome alpha subunit D2) {Arabidopsis thaliana}, cDNA proteasome subunit prcga GI:2511571 Length = 199 Score = 25.4 bits (53), Expect = 5.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 62 LHRWWRLPALTPPEHRLARASTDPGTLLMFRQYQRLTPSL 181 LH+ +T H+L AS +PG + F +Y + SL Sbjct: 27 LHKNKEDKIMTLDSHKLVAASGEPGDRVQFTEYVQKNVSL 66 >At3g22630.1 68416.m02857 20S proteasome beta subunit D (PBD1) (PRGB) identical to GB:CAA74026 from [Arabidopsis thaliana] ( FEBS Lett. (1997) 416 (3), 281-285); identical to cDNA proteasome subunit prgb GI:2511589 Length = 204 Score = 25.4 bits (53), Expect = 5.2 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +2 Query: 104 HRLARASTDPGTLLMFRQYQRLTPSLQLSAR*KLVIPLTWLSAA 235 H+L AS +PG + F +Y + SL + + IPLT +AA Sbjct: 41 HKLVAASGEPGDRVQFTEYVQKNVSLY---KFRNGIPLTTAAAA 81 >At2g33580.1 68415.m04115 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein protein kinase [Arabidopsis thaliana] GI:2852449; contains Pfam profiles PF01476: LysM domain, PF00069: Protein kinase domain Length = 664 Score = 25.4 bits (53), Expect = 5.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 114 RVLRLIPARC*CSDSTSALHHH 179 R L +IPA C CS S+ + H Sbjct: 103 RELVVIPANCSCSSSSGGFYQH 124 >At2g24640.1 68415.m02943 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 15 (UBP15) [Arabidopsis thaliana] GI:11993475; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 672 Score = 25.4 bits (53), Expect = 5.2 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -2 Query: 237 FAADNHVNGMTSFYRADSCSDGVRRWYCLNISSVPGSVEARARRCSGG 94 F A + G + Y+ D C D V+ L+I P + +R GG Sbjct: 343 FTAKEWLQG-DNLYKCDRCDDYVKACKRLSIRCAPNILTIALKRFQGG 389 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 25.4 bits (53), Expect = 5.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 243 GCFAADNHVNGMTSFYRADSCSDGVRRWY 157 G + D +VNG+ + A + DG R WY Sbjct: 352 GQYVGDGNVNGVGAGAGAGAGFDGERAWY 380 >At1g34550.1 68414.m04294 expressed protein contains Pfam profile PF04765: Protein of unknown function (DUF616); expression supported by MPSS Length = 812 Score = 25.4 bits (53), Expect = 5.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 6 LRDDSLKFIER*CHLRSSSCIGGGAYQRLP 95 L +D +I R CH+ SSCI G + + P Sbjct: 459 LTEDDTNYISR-CHIAVSSCIFGNSDRLRP 487 >At5g37470.1 68418.m04509 hypothetical protein contains Pfam PF04510 : Family of unknown function (DUF577)); common family comprised of At5g37410, At5g37400, At5g37920, At5g37460, At5g37650, At5g37470, At5g37420, At5g37430 Length = 629 Score = 25.0 bits (52), Expect = 6.9 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -2 Query: 252 FVFGCFAADNHVNGMTSFYRA--DSCSDGVRRWYCLNISS 139 F CF ADN N +T + S+GV R+Y L + S Sbjct: 43 FALFCFCADNFPNCLTLMFLKLYRHSSNGVIRFYSLYLLS 82 >At1g72310.1 68414.m08359 zinc finger (C3HC4-type RING finger) family protein (ATL3) identical to RING-H2 zinc finger protein (ATL3) GB:AF132013 (Arabidopsis thaliana) Length = 324 Score = 25.0 bits (52), Expect = 6.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 201 FYRADSCSDGVRRWYCLN 148 F+R DSC DG+ CL+ Sbjct: 115 FFRQDSCKDGLECSICLS 132 >At5g64816.2 68418.m08154 expressed protein Length = 130 Score = 24.6 bits (51), Expect = 9.1 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 189 DSCSDGVRRWYCLNISSVPGSVEARARRC 103 D+CSD R C+N V + RRC Sbjct: 85 DACSDACARTVCVNQHQVANWNDICLRRC 113 >At5g64816.1 68418.m08153 expressed protein Length = 130 Score = 24.6 bits (51), Expect = 9.1 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 189 DSCSDGVRRWYCLNISSVPGSVEARARRC 103 D+CSD R C+N V + RRC Sbjct: 85 DACSDACARTVCVNQHQVANWNDICLRRC 113 >At5g52050.1 68418.m06460 MATE efflux protein-related contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 505 Score = 24.6 bits (51), Expect = 9.1 Identities = 11/43 (25%), Positives = 18/43 (41%) Frame = -2 Query: 252 FVFGCFAADNHVNGMTSFYRADSCSDGVRRWYCLNISSVPGSV 124 F++ CF D ++C D VR W L ++P + Sbjct: 233 FLYICFFEDKLSVNEDEKITEETCEDSVREWKKLLCLAIPSCI 275 >At5g51930.1 68418.m06442 glucose-methanol-choline (GMC) oxidoreductase family protein similar to mandelonitrile lyase from Prunus serotina [SP|P52706, SP|P52707]; contains Pfam profile PF00732 GMC oxidoreductase Length = 582 Score = 24.6 bits (51), Expect = 9.1 Identities = 10/19 (52%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +3 Query: 147 CSDS-TSALHHHYSCQLGK 200 C D+ TS H+H CQ+GK Sbjct: 525 CIDTVTSVWHYHGGCQVGK 543 >At5g10080.1 68418.m01168 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 528 Score = 24.6 bits (51), Expect = 9.1 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 163 APYTITTAVSSVKAGHSIDVVISGKTP 243 +P + T + GH++ I+GKTP Sbjct: 470 SPNPLPTDEQQSRGGHAVSPAIAGKTP 496 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 24.6 bits (51), Expect = 9.1 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 103 APPSACFD*SRHAADVQTVPAPYTITTAVSSVKAGHSIDVVISGKTPEDKM 255 A PS + S + + PAP+ ++ S+ G D+V T ED+M Sbjct: 590 AAPSFSWPGSSQPQQLSSTPAPFPASSPTSASPFGEKKDIV---DTQEDEM 637 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,120,510 Number of Sequences: 28952 Number of extensions: 108090 Number of successful extensions: 269 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 269 length of database: 12,070,560 effective HSP length: 67 effective length of database: 10,130,776 effective search space used: 212746296 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -