BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J15 (653 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 23 2.2 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 6.7 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 476 ILVLAFSAFFLWMYSMRTRLFLNTLPFAFMY 384 +L+L F A+ LW+ S+ R+F + +F Y Sbjct: 125 VLLLLFDAY-LWISSVGVRMFQYYIGRSFTY 154 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 6.7 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 5/71 (7%) Frame = -1 Query: 209 LRTRAREWTATGFLMTRPSLIILRMFCLELVLAIS-----LISFGSSHTFFLPHRITEAA 45 L RA E+ A GF +L+ + +L I LI+FG S+ F P +I Sbjct: 1067 LNERA-EFNAAGFFPIDYTLVFSKFTSSIRMLLIQGQIFGLITFGCSNRCFFPSKIRICW 1125 Query: 44 SLFCNFRELIL 12 ++ N L L Sbjct: 1126 NVLLNCVYLFL 1136 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,511 Number of Sequences: 336 Number of extensions: 2478 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -