BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J10 (577 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 22 3.3 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 22 4.3 AF321227-6|AAK16426.1| 150|Tribolium castaneum Pb protein. 21 9.9 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 21 9.9 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 22.2 bits (45), Expect = 3.3 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +3 Query: 432 PSSWTFHCNIQ 464 P W FHC+I+ Sbjct: 597 PGYWLFHCHIE 607 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.8 bits (44), Expect = 4.3 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +3 Query: 228 SKIRLLQYKNK*IWRNRRNHKWHG*RCGQYRPQSLS 335 S+I ++YKN WRN R R Q+ + LS Sbjct: 323 SEIYNVEYKNVEFWRNIREDYDRLARLTQFLDKELS 358 >AF321227-6|AAK16426.1| 150|Tribolium castaneum Pb protein. Length = 150 Score = 20.6 bits (41), Expect = 9.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 Query: 239 ADFRTVLPFTSGD 201 A+F T LP SGD Sbjct: 68 AEFMTALPHLSGD 80 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 20.6 bits (41), Expect = 9.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 Query: 239 ADFRTVLPFTSGD 201 A+F T LP SGD Sbjct: 68 AEFMTALPHLSGD 80 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,150 Number of Sequences: 336 Number of extensions: 3164 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14308417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -