SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0002_J10
         (577 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     22   3.3  
AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory recept...    22   4.3  
AF321227-6|AAK16426.1|  150|Tribolium castaneum Pb protein.            21   9.9  
AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia or...    21   9.9  

>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 22.2 bits (45), Expect = 3.3
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +3

Query: 432 PSSWTFHCNIQ 464
           P  W FHC+I+
Sbjct: 597 PGYWLFHCHIE 607


>AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory receptor
           candidate 15 protein.
          Length = 455

 Score = 21.8 bits (44), Expect = 4.3
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +3

Query: 228 SKIRLLQYKNK*IWRNRRNHKWHG*RCGQYRPQSLS 335
           S+I  ++YKN   WRN R       R  Q+  + LS
Sbjct: 323 SEIYNVEYKNVEFWRNIREDYDRLARLTQFLDKELS 358


>AF321227-6|AAK16426.1|  150|Tribolium castaneum Pb protein.
          Length = 150

 Score = 20.6 bits (41), Expect = 9.9
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -3

Query: 239 ADFRTVLPFTSGD 201
           A+F T LP  SGD
Sbjct: 68  AEFMTALPHLSGD 80


>AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 477

 Score = 20.6 bits (41), Expect = 9.9
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -3

Query: 239 ADFRTVLPFTSGD 201
           A+F T LP  SGD
Sbjct: 68  AEFMTALPHLSGD 80


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 139,150
Number of Sequences: 336
Number of extensions: 3164
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14308417
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -