BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J07 (421 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0146 - 953957-956278,956468-956786,957185-957213 32 0.22 03_05_0517 - 25118232-25118730,25119002-25119273 31 0.28 09_02_0511 - 10079180-10079355,10079656-10079722,10080144-100801... 31 0.50 12_02_0216 + 15804110-15804284,15804341-15804351 29 2.0 08_02_1277 + 25823835-25825113,25825201-25825418,25825501-258257... 29 2.0 02_05_0425 - 28845707-28846189,28846262-28846403,28846496-288469... 28 3.5 11_01_0532 + 4201374-4201401,4201475-4202652,4204316-4204670,420... 27 4.6 08_02_0218 - 14405739-14406096,14406322-14406326 27 6.1 08_01_0364 - 3218309-3218414,3218882-3218941,3219898-3219969,322... 27 6.1 07_03_0817 - 21735283-21735358,21735719-21735796,21735885-217359... 27 6.1 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 27 6.1 03_05_0899 - 28619081-28619208,28619309-28619369,28619936-286200... 27 6.1 02_04_0186 + 20754045-20754692,20754772-20755057,20756160-20756668 27 6.1 12_01_1022 - 10435409-10435564,10435950-10436219,10436820-104371... 27 8.1 12_01_0495 - 3935395-3937110 27 8.1 10_08_0654 - 19616426-19616656,19617046-19617249,19617654-196178... 27 8.1 07_03_0380 + 17460078-17460782,17461194-17461252,17461388-174614... 27 8.1 05_02_0114 + 6753868-6754126,6754225-6754592,6754704-6754992,675... 27 8.1 04_03_0961 + 21263735-21263773,21264157-21264279,21266774-212668... 27 8.1 04_03_0742 + 19200045-19200053,19200158-19200437,19201331-192015... 27 8.1 03_06_0327 - 33158131-33158315,33158586-33158639,33159149-331591... 27 8.1 03_02_0260 - 6924532-6924757,6925443-6925546,6925729-6926007,692... 27 8.1 01_05_0233 - 19641309-19641871,19650741-19650892,19651193-19651308 27 8.1 01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 27 8.1 >05_01_0146 - 953957-956278,956468-956786,957185-957213 Length = 889 Score = 31.9 bits (69), Expect = 0.22 Identities = 19/43 (44%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +3 Query: 210 PSNGPSG-NYEPISTG-PAYVDFNHPNYPPQAIRQPSRPGVGR 332 PS SG N PIS G P+ NH P +I +PS PG R Sbjct: 6 PSKSRSGPNESPISRGRPSTPSSNHRPSTPSSIHRPSTPGATR 48 >03_05_0517 - 25118232-25118730,25119002-25119273 Length = 256 Score = 31.5 bits (68), Expect = 0.28 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +3 Query: 192 DPFFSQPSNGPSGNYEPISTGPAYVDFNHPNYPPQAIRQPS 314 D FF++ P GN T P VD P P +A Q S Sbjct: 37 DWFFTRKGESPQGNISKEETAPTGVDVTDPGRPGRAFTQDS 77 >09_02_0511 - 10079180-10079355,10079656-10079722,10080144-10080181, 10080255-10080336 Length = 120 Score = 30.7 bits (66), Expect = 0.50 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 81 VHVVDHNPDYNPGQVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNG 221 V+ V + +PG +++N+G S GN ++ N PFF SNG Sbjct: 41 VYDVTSYVEEHPGGDEILNNAGATSKGNYALILPVNEFPFFLVYSNG 87 >12_02_0216 + 15804110-15804284,15804341-15804351 Length = 61 Score = 28.7 bits (61), Expect = 2.0 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +3 Query: 141 SGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAY 263 SG P+ +H V FF+ SN SGNY + G + Sbjct: 12 SGSPAPPYKNHTVAGADGWFFNATSNTTSGNYSDWAAGETF 52 >08_02_1277 + 25823835-25825113,25825201-25825418,25825501-25825724, 25826468-25827080,25827735-25827775,25830549-25831191, 25832595-25834012,25834110-25834251,25834415-25834522, 25835346-25835558,25835643-25835753,25836099-25836293, 25836555-25836695,25836835-25836909 Length = 1806 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +3 Query: 195 PFFSQPSNGPSGNYEPISTGPAYVDFNHPNYPPQAIRQPSR 317 P + +P+ P EP+ Y+ ++ P+YP + ++P+R Sbjct: 152 PPYDRPNYPPPSPQEPVRNS-YYMSYDRPSYPAASPQEPTR 191 >02_05_0425 - 28845707-28846189,28846262-28846403,28846496-28846971, 28848817-28848848,28849429-28849572,28849770-28849841, 28850281-28850296 Length = 454 Score = 27.9 bits (59), Expect = 3.5 Identities = 18/66 (27%), Positives = 28/66 (42%) Frame = +3 Query: 129 VVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAYVDFNHPNYPPQAIRQ 308 ++D SG SDG + + + + +G ST NH ++ P+ IR Sbjct: 129 IIDESGFTSDGAGEAYT-------YMRTTTASAGARAAPSTWDLPPKVNHRSFQPRVIRS 181 Query: 309 PSRPGV 326 PS GV Sbjct: 182 PSASGV 187 >11_01_0532 + 4201374-4201401,4201475-4202652,4204316-4204670, 4204791-4204864,4206965-4207056,4207500-4207573, 4207680-4207822,4207889-4207909 Length = 654 Score = 27.5 bits (58), Expect = 4.6 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = +3 Query: 93 DHNPDYNPGQVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGP 257 DH+ D + V+ D+S VP D + D + DP + EP+S P Sbjct: 40 DHSDDSDSAAVNEDDDSAVPEDAD-DETLAGAEDPVLDLREAEVLPSAEPVSAFP 93 >08_02_0218 - 14405739-14406096,14406322-14406326 Length = 120 Score = 27.1 bits (57), Expect = 6.1 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 1/66 (1%) Frame = +3 Query: 138 NSGVP-SDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAYVDFNHPNYPPQAIRQPS 314 N +P S G D + ++ FS PS+G + P +D H Y + P+ Sbjct: 31 NYALPLSVGAPDLIPLSLTSSLFSLPSHGKWQPHHRSYLPPCQLDRFHQPYNLVGLHMPN 90 Query: 315 RPGVGR 332 + GVG+ Sbjct: 91 KCGVGK 96 >08_01_0364 - 3218309-3218414,3218882-3218941,3219898-3219969, 3220080-3223195,3223303-3223561,3223665-3223951, 3224029-3224364,3224463-3224604,3224690-3224910, 3224990-3225151,3225242-3225400,3225488-3225787, 3226306-3226569,3227370-3227453 Length = 1855 Score = 27.1 bits (57), Expect = 6.1 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +3 Query: 195 PFFSQPSNGPSGNYEPISTGPAYVDFN--HPNYPPQAIRQPSRPG 323 P +SQPS S ++G D++ PNY P P+ PG Sbjct: 1788 PSYSQPSPSYSPTSPYTTSGGPSPDYSPTSPNYSPSGSYSPTAPG 1832 >07_03_0817 - 21735283-21735358,21735719-21735796,21735885-21735945, 21736038-21736069,21736144-21736221,21738046-21738213, 21738711-21738897,21740019-21740160 Length = 273 Score = 27.1 bits (57), Expect = 6.1 Identities = 20/57 (35%), Positives = 24/57 (42%) Frame = +3 Query: 189 PDPFFSQPSNGPSGNYEPISTGPAYVDFNHPNYPPQAIRQPSRPGVGR*MSHKDXRF 359 P PF S P G Y+PI GP V P + P + RP G +H D F Sbjct: 216 PVPFGGPGSVPPGGRYDPI--GPPDV----PGFEPSRFVRRPRPPAG--TTHPDLEF 264 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 27.1 bits (57), Expect = 6.1 Identities = 14/48 (29%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +3 Query: 195 PFFSQPSNGPSGNYEPISTG--PAYVDFNHPNYPPQAIRQPSRPGVGR 332 P+ P P G+Y P+ G P Y + P P ++ P P G+ Sbjct: 418 PYMGAPPPPPPGSYAPVPWGQPPPYASYPPPP-PGSSMYNPPPPAPGQ 464 >03_05_0899 - 28619081-28619208,28619309-28619369,28619936-28620095, 28620200-28620237,28620341-28620394,28620562-28620636, 28620744-28620872,28621172-28621259,28621340-28621446, 28621547-28621595,28621683-28621786,28622019-28622133, 28622517-28622596 Length = 395 Score = 27.1 bits (57), Expect = 6.1 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 210 PSNGPSGNYEPISTGPAYVDFNHPNYPPQAI-RQPSRPG 323 PS P N++ STG A D + PQAI R P R G Sbjct: 74 PSKLPKWNFDGSSTGQATGDDSEVILHPQAIFRDPFRKG 112 >02_04_0186 + 20754045-20754692,20754772-20755057,20756160-20756668 Length = 480 Score = 27.1 bits (57), Expect = 6.1 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 88 WSIITLIIIQGRFTWWTIVVFHR 156 W+ I + I+ G W+T++V H+ Sbjct: 317 WAAIVMGILSGSIPWYTMMVLHK 339 >12_01_1022 - 10435409-10435564,10435950-10436219,10436820-10437125, 10437932-10438057,10439825-10439893,10440443-10440487, 10440717-10440776,10441527-10441589,10442186-10442266, 10442494-10442916 Length = 532 Score = 26.6 bits (56), Expect = 8.1 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +3 Query: 162 NSDHVVIANPDPFFSQPSNGPSGNYEPIS-TGPAYVDFNHPNYPP 293 N HV P P +S P G Y P G V N P YPP Sbjct: 357 NEHHVPFIAPSPSYSAGMLPPQGMYPPPEWNGYHQVPLN-PYYPP 400 >12_01_0495 - 3935395-3937110 Length = 571 Score = 26.6 bits (56), Expect = 8.1 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +3 Query: 93 DHNPDYNPGQVHVVDNSGVPSDGNSD--HVVIANPDP 197 DH Y+ HVVD P G D HV +A P P Sbjct: 342 DHYLGYHSHDAHVVDAEATPEQGYHDDAHVAVA-PAP 377 >10_08_0654 - 19616426-19616656,19617046-19617249,19617654-19617824, 19619617-19620411 Length = 466 Score = 26.6 bits (56), Expect = 8.1 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +3 Query: 177 VIANPDPFFSQPSNGPSGNYEPISTGPAYVDFNHPNYPPQAIRQPSRPGV 326 + ANP S P PS P++ A + H PPQ +Q +PG+ Sbjct: 42 ITANP----SSPDPAPSAPLPPLAPREADLVAPHLPPPPQQQQQQQQPGI 87 >07_03_0380 + 17460078-17460782,17461194-17461252,17461388-17461492, 17461732-17461867,17461919-17461939 Length = 341 Score = 26.6 bits (56), Expect = 8.1 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 84 HVVDHNPDYNPGQVHVVDNSGVPSDGNSDHVVIA 185 H+V+ P + G+ V + VP DG +H+V++ Sbjct: 282 HIVERKP-FRCGRYPPVVRTAVPVDGRFEHIVLS 314 >05_02_0114 + 6753868-6754126,6754225-6754592,6754704-6754992, 6755838-6755909,6757440-6757666 Length = 404 Score = 26.6 bits (56), Expect = 8.1 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 213 SNGPSGNYEPISTGPAYVDFNHPNYPPQAIRQPS-RPGVGR 332 S +GN+ S G + FNH Y R+P+ RP GR Sbjct: 40 SYSDTGNFVLQSAGLPSIPFNHSPYGDTFFRRPTGRPSDGR 80 >04_03_0961 + 21263735-21263773,21264157-21264279,21266774-21266847, 21266939-21267095,21267554-21267694,21267739-21267823, 21268810-21268903,21269041-21269239,21269515-21269549, 21270076-21270631,21270722-21270882,21271704-21271718, 21273078-21273330,21273439-21273562,21273688-21273788, 21274870-21274938,21275060-21275191,21275270-21275404, 21275489-21275551,21275636-21275881,21276007-21276285 Length = 1026 Score = 26.6 bits (56), Expect = 8.1 Identities = 11/54 (20%), Positives = 24/54 (44%) Frame = +3 Query: 87 VVDHNPDYNPGQVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPIS 248 ++ P+ G + + N+G+P +S N +P + + N EP++ Sbjct: 340 LIKDEPNTQDGNNNTIQNTGIPIIASSSEFTPMNVEPSIASSNEFTPMNVEPLN 393 >04_03_0742 + 19200045-19200053,19200158-19200437,19201331-19201545, 19201705-19201792,19202277-19202842 Length = 385 Score = 26.6 bits (56), Expect = 8.1 Identities = 19/62 (30%), Positives = 22/62 (35%) Frame = +3 Query: 135 DNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAYVDFNHPNYPPQAIRQPS 314 D D D IA + + P Y P G AY P+YPP QPS Sbjct: 301 DGEEKDKDKEKDPAAIAAANLYLHYPRFAFPAGYYPPGPGYAYPPPYPPSYPPP--YQPS 358 Query: 315 RP 320 P Sbjct: 359 YP 360 >03_06_0327 - 33158131-33158315,33158586-33158639,33159149-33159180, 33159275-33159369,33159466-33159539,33159643-33159778, 33159874-33159937,33160017-33160079,33160160-33160299, 33160487-33160627,33160747-33160868,33160947-33161112, 33161194-33161313,33161580-33161651,33161787-33161843, 33162036-33162152,33162231-33162369,33162794-33162900, 33162972-33163081,33163172-33163305,33163397-33163546, 33163635-33163840,33166123-33166818 Length = 1059 Score = 26.6 bits (56), Expect = 8.1 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = +3 Query: 96 HNPDYNPGQVHVVDNSGVPSDG---NSDHVVIANPDPFFSQPSNGPSGNYEPISTGPA 260 H Y PG V+ + GVP G S V I P P S+ P+ Y+P + PA Sbjct: 83 HQGAYQPGGVYRAPSPGVPVIGGYARSTPVTIRAPPP---SHSSAPA-PYQPAAAAPA 136 >03_02_0260 - 6924532-6924757,6925443-6925546,6925729-6926007, 6926093-6926368,6926460-6926678,6926758-6926926, 6927208-6927382,6927489-6927600,6929566-6929820 Length = 604 Score = 26.6 bits (56), Expect = 8.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 129 VVDNSGVPSDGNSDHVVIANPDPFFSQP 212 V++N +P N HVV+ANP P P Sbjct: 248 VLENCQLPH-ANHGHVVLANPSPILFYP 274 >01_05_0233 - 19641309-19641871,19650741-19650892,19651193-19651308 Length = 276 Score = 26.6 bits (56), Expect = 8.1 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 4/67 (5%) Frame = +3 Query: 117 GQVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGP---SGNYE-PISTGPAYVDFNHPN 284 G ++ VD+ + + + +I P P SQP P SG + P +TG H Sbjct: 40 GDLYEVDSEDMNHEKFWNGSIIELPQPSLSQPKGAPWSKSGEEKIPSATGAVPGYLQHLR 99 Query: 285 YPPQAIR 305 P A+R Sbjct: 100 VSPDAVR 106 >01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 Length = 580 Score = 26.6 bits (56), Expect = 8.1 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +3 Query: 141 SGVPSD-GNSDHVVIANPDPFF-SQPSNGPSGNYEPIST 251 SG PS GN+ + ++P PF S PS+G SGNY + T Sbjct: 464 SGSPSHRGNAG--MKSSPSPFAPSGPSSGGSGNYGRLPT 500 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,203,048 Number of Sequences: 37544 Number of extensions: 271691 Number of successful extensions: 720 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 766563072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -