BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J07 (421 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 24 2.0 EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 23 4.5 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 6.0 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 24.2 bits (50), Expect = 2.0 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = +3 Query: 183 ANPDPFFSQPSNGPSGNYEPISTGPAYVDFNHPNYPPQAIRQPSRPGVG 329 A+PD F S P + +S ++ P +PP PGVG Sbjct: 370 AHPDHFLDHRSPSPQRGNQSLSQMTEILEAIQPEFPPTP--PQLSPGVG 416 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 23.0 bits (47), Expect = 4.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 11 TLFDNESFRVFLLRRIGHGCRKQS 82 TLFD E F VF + G KQS Sbjct: 319 TLFDREGFAVFRDHKSMLGALKQS 342 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 22.6 bits (46), Expect = 6.0 Identities = 7/28 (25%), Positives = 18/28 (64%) Frame = +1 Query: 325 WEGKCLIKXSDFQTRRNDD*SYNIFQIL 408 W + + D+Q+R++ D ++++ Q+L Sbjct: 956 WTHRVIPSVGDWQSRKHGDMTFHLAQVL 983 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 459,945 Number of Sequences: 2352 Number of extensions: 10376 Number of successful extensions: 41 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -