BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J07 (421 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 24 0.61 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 5.6 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 5.6 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 20 9.9 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 24.2 bits (50), Expect = 0.61 Identities = 14/58 (24%), Positives = 21/58 (36%) Frame = +3 Query: 159 GNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAYVDFNHPNYPPQAIRQPSRPGVGR 332 GN+ + I P P + EP + P Y+ P +P + PG R Sbjct: 71 GNNRPIYIPQPRPPHPRLRREAESEAEPGNNRPVYIPQPRPPHPRLRREPEAEPGNNR 128 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.0 bits (42), Expect = 5.6 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = +1 Query: 46 SSPYWPWLPQTECTWSIITLIII 114 S+P W + P TW I ++++ Sbjct: 549 SAPVWRFQPWGPFTWGGIGVVVL 571 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 5.6 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = +3 Query: 78 RVHVVDHNPDYNPGQVHV 131 R + + +PD + GQ+H+ Sbjct: 897 RFYSISSSPDVHQGQIHL 914 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 20.2 bits (40), Expect = 9.9 Identities = 7/22 (31%), Positives = 10/22 (45%) Frame = +3 Query: 261 YVDFNHPNYPPQAIRQPSRPGV 326 YVD N+ YP + R + Sbjct: 171 YVDINYVEYPQNSKRNSEESAI 192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,042 Number of Sequences: 438 Number of extensions: 2947 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10750329 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -