BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J06 (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g00050.1 68417.m00005 basic helix-loop-helix (bHLH) family pr... 53 1e-07 At3g59060.2 68416.m06584 basic helix-loop-helix (bHLH) family pr... 53 1e-07 At3g59060.1 68416.m06583 basic helix-loop-helix (bHLH) family pr... 53 1e-07 At2g43010.2 68415.m05338 phytochrome-interacting factor 4 (PIF4)... 50 1e-06 At2g43010.1 68415.m05337 phytochrome-interacting factor 4 (PIF4)... 50 1e-06 At1g09530.2 68414.m01069 phytochrome interacting factor 3 (PIF3)... 48 4e-06 At1g09530.1 68414.m01068 phytochrome interacting factor 3 (PIF3)... 48 4e-06 At1g69010.1 68414.m07896 basic helix-loop-helix (bHLH) family pr... 47 1e-05 At2g46970.1 68415.m05867 basic helix-loop-helix (bHLH) protein, ... 46 1e-05 At2g20180.2 68415.m02360 basic helix-loop-helix (bHLH) family pr... 46 2e-05 At2g20180.1 68415.m02359 basic helix-loop-helix (bHLH) family pr... 46 2e-05 At3g23690.1 68416.m02979 basic helix-loop-helix (bHLH) family pr... 44 7e-05 At2g18300.2 68415.m02134 basic helix-loop-helix (bHLH) family pr... 44 7e-05 At2g18300.1 68415.m02133 basic helix-loop-helix (bHLH) family pr... 44 7e-05 At4g30980.1 68417.m04397 basic helix-loop-helix (bHLH) family pr... 44 9e-05 At1g26260.2 68414.m03204 basic helix-loop-helix (bHLH) family pr... 43 1e-04 At1g26260.1 68414.m03203 basic helix-loop-helix (bHLH) family pr... 43 1e-04 At4g36540.2 68417.m05189 basic helix-loop-helix (bHLH) family pr... 42 3e-04 At4g36540.1 68417.m05188 basic helix-loop-helix (bHLH) family pr... 42 3e-04 At4g36930.1 68417.m05235 basic helix-loop-helix (bHLH) protein S... 42 4e-04 At2g24260.1 68415.m02898 basic helix-loop-helix (bHLH) family pr... 41 5e-04 At1g10120.1 68414.m01141 basic helix-loop-helix (bHLH) family pr... 41 5e-04 At1g03040.1 68414.m00276 basic helix-loop-helix (bHLH) family pr... 41 6e-04 At4g28790.2 68417.m04116 basic helix-loop-helix (bHLH) family pr... 40 0.001 At4g28790.1 68417.m04117 basic helix-loop-helix (bHLH) family pr... 40 0.001 At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family pr... 40 0.001 At5g61270.1 68418.m07689 basic helix-loop-helix (bHLH) family pr... 39 0.002 At5g38860.1 68418.m04700 basic helix-loop-helix (bHLH) family pr... 39 0.002 At1g68920.2 68414.m07888 basic helix-loop-helix (bHLH) family pr... 39 0.002 At1g68920.1 68414.m07887 basic helix-loop-helix (bHLH) family pr... 39 0.002 At5g58010.1 68418.m07258 basic helix-loop-helix (bHLH) family pr... 39 0.003 At4g28800.1 68417.m04118 bHLH family protein contains Pfam profi... 39 0.003 At4g27120.2 68417.m03898 expressed protein 39 0.003 At4g27120.1 68417.m03897 expressed protein 39 0.003 At5g08130.1 68418.m00948 basic helix-loop-helix (bHLH) family pr... 38 0.003 At3g07340.1 68416.m00875 basic helix-loop-helix (bHLH) family pr... 38 0.003 At4g37850.1 68417.m05354 basic helix-loop-helix (bHLH) family pr... 38 0.004 At4g34530.1 68417.m04907 basic helix-loop-helix (bHLH) family pr... 38 0.004 At1g02340.1 68414.m00180 long hypocotyl in far-red 1 (HFR1) / re... 38 0.006 At5g67110.1 68418.m08461 basic helix-loop-helix (bHLH) family pr... 37 0.008 At1g59640.2 68414.m06708 basic helix-loop-helix (bHLH) family pr... 37 0.008 At1g59640.1 68414.m06707 basic helix-loop-helix (bHLH) family pr... 37 0.008 At3g57800.2 68416.m06443 basic helix-loop-helix (bHLH) family pr... 37 0.010 At2g22750.1 68415.m02697 basic helix-loop-helix (bHLH) family pr... 37 0.010 At5g62610.1 68418.m07857 basic helix-loop-helix (bHLH) family pr... 36 0.013 At2g42300.1 68415.m05236 basic helix-loop-helix (bHLH) family pr... 36 0.018 At5g50915.2 68418.m06314 basic helix-loop-helix (bHLH) family pr... 35 0.041 At5g50915.1 68418.m06313 basic helix-loop-helix (bHLH) family pr... 35 0.041 At5g48560.1 68418.m06005 basic helix-loop-helix (bHLH) family pr... 35 0.041 At3g57800.1 68416.m06442 basic helix-loop-helix (bHLH) family pr... 34 0.054 At4g01720.1 68417.m00223 WRKY family transcription factor simila... 34 0.072 At1g76180.1 68414.m08846 dehydrin (ERD14) identical to SP|P42763... 33 0.17 At1g25330.1 68414.m03143 basic helix-loop-helix (bHLH) family pr... 33 0.17 At4g17880.1 68417.m02665 basic helix-loop-helix (bHLH) family pr... 32 0.22 At2g40200.1 68415.m04943 basic helix-loop-helix (bHLH) family pr... 32 0.29 At2g31210.1 68415.m03811 basic helix-loop-helix (bHLH) family pr... 31 0.38 At1g50410.1 68414.m05650 SNF2 domain-containing protein / helica... 31 0.38 At1g27740.1 68414.m03390 basic helix-loop-helix (bHLH) family pr... 31 0.38 At1g01260.1 68414.m00043 basic helix-loop-helix (bHLH) family pr... 31 0.38 At3g28770.1 68416.m03591 expressed protein 31 0.51 At3g20640.1 68416.m02612 ethylene-responsive protein -related co... 31 0.51 At1g61660.2 68414.m06950 basic helix-loop-helix (bHLH) family pr... 31 0.51 At1g61660.1 68414.m06949 basic helix-loop-helix (bHLH) family pr... 31 0.51 At1g25310.1 68414.m03141 basic helix-loop-helix (bHLH) family pr... 31 0.51 At1g22450.1 68414.m02806 cytochrome c oxidase subunit 6b, putati... 31 0.51 At5g46760.1 68418.m05760 basic helix-loop-helix (bHLH) family pr... 30 0.89 At5g41315.1 68418.m05021 basic helix-loop-helix (bHLH) family pr... 30 0.89 At5g37800.1 68418.m04552 basic helix-loop-helix (bHLH) family pr... 30 0.89 At4g29930.1 68417.m04258 basic helix-loop-helix (bHLH) family pr... 30 0.89 At4g00870.1 68417.m00118 basic helix-loop-helix (bHLH) family pr... 30 0.89 At3g19510.1 68416.m02472 homeobox protein (HAT 3.1) identical to... 30 0.89 At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family pr... 30 0.89 At2g44200.1 68415.m05500 expressed protein 30 0.89 At2g14760.1 68415.m01667 basic helix-loop-helix protein / bHLH p... 30 0.89 At1g63650.2 68414.m07202 basic helix-loop-helix (bHLH) family pr... 30 0.89 At1g63650.1 68414.m07201 basic helix-loop-helix (bHLH) family pr... 30 0.89 At3g29075.1 68416.m03637 glycine-rich protein 29 1.5 At3g25710.1 68416.m03199 basic helix-loop-helix (bHLH) family pr... 29 1.5 At1g68810.1 68414.m07866 basic helix-loop-helix (bHLH) family pr... 29 1.5 At5g63720.1 68418.m07998 hypothetical protein 29 2.0 At5g43650.1 68418.m05335 basic helix-loop-helix (bHLH) family pr... 29 2.0 At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiqui... 29 2.0 At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui... 29 2.0 At2g45130.1 68415.m05616 SPX (SYG1/Pho81/XPR1) domain-containing... 29 2.0 At1g66470.1 68414.m07551 basic helix-loop-helix (bHLH) family pr... 29 2.0 At1g12860.1 68414.m01494 basic helix-loop-helix (bHLH) family pr... 29 2.0 At4g16430.1 68417.m02487 basic helix-loop-helix (bHLH) family pr... 29 2.7 At3g30725.1 68416.m03909 expressed protein ; expression supporte... 29 2.7 At2g22770.1 68415.m02701 basic helix-loop-helix (bHLH) family pr... 29 2.7 At2g20310.1 68415.m02372 expressed protein 29 2.7 At2g06210.2 68415.m00683 phosphoprotein-related low similarity t... 29 2.7 At2g06210.1 68415.m00684 phosphoprotein-related low similarity t... 29 2.7 At3g30775.1 68416.m03933 proline oxidase, mitochondrial / osmoti... 28 3.6 At2g31730.1 68415.m03874 ethylene-responsive protein, putative s... 28 3.6 At2g28160.1 68415.m03420 basic helix-loop-helix (bHLH) family pr... 28 3.6 At2g02480.1 68415.m00187 DNA polymerase-related weak similarity ... 28 3.6 At1g32640.1 68414.m04026 basic helix-loop-helix (bHLH) protein (... 28 3.6 At5g16500.1 68418.m01928 protein kinase family protein contains ... 28 4.7 At3g21480.1 68416.m02710 transcription activation domain-interac... 28 4.7 At1g17820.1 68414.m02206 expressed protein 28 4.7 At5g41090.1 68418.m04995 no apical meristem (NAM) family protein... 27 6.2 At4g33880.1 68417.m04807 basic helix-loop-helix (bHLH) family pr... 27 6.2 At4g09820.1 68417.m01611 basic helix-loop-helix (bHLH) family pr... 27 6.2 At4g04890.1 68417.m00712 homeobox-leucine zipper protein protode... 27 6.2 At3g14010.1 68416.m01769 hydroxyproline-rich glycoprotein family... 27 6.2 At2g41130.1 68415.m05080 basic helix-loop-helix (bHLH) family pr... 27 6.2 At2g03810.2 68415.m00341 18S pre-ribosomal assembly protein gar2... 27 6.2 At2g03810.1 68415.m00340 18S pre-ribosomal assembly protein gar2... 27 6.2 At1g77500.1 68414.m09025 expressed protein contains Pfam domains... 27 6.2 At1g57680.2 68414.m06546 expressed protein 27 6.2 At1g57680.1 68414.m06545 expressed protein 27 6.2 At1g52160.1 68414.m05887 metallo-beta-lactamase family protein 27 6.2 At1g30670.1 68414.m03750 basic helix-loop-helix (bHLH) family pr... 27 6.2 At1g14687.1 68414.m01755 zinc finger homeobox family protein / Z... 27 6.2 At1g10610.1 68414.m01202 basic helix-loop-helix (bHLH) family pr... 27 6.2 At5g56960.1 68418.m07110 basic helix-loop-helix (bHLH) family pr... 27 8.3 At4g29550.1 68417.m04214 expressed protein contains Pfam profile... 27 8.3 At4g27290.1 68417.m03916 S-locus protein kinase, putative simila... 27 8.3 At3g29763.1 68416.m03760 hypothetical protein 27 8.3 At2g22760.1 68415.m02699 basic helix-loop-helix (bHLH) family pr... 27 8.3 At2g16910.1 68415.m01948 basic helix-loop-helix (bHLH) family pr... 27 8.3 At1g29570.1 68414.m03616 zinc finger protein-related contains si... 27 8.3 At1g19260.1 68414.m02396 hAT dimerisation domain-containing prot... 27 8.3 >At4g00050.1 68417.m00005 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 399 Score = 52.8 bits (121), Expect = 1e-07 Identities = 34/99 (34%), Positives = 53/99 (53%), Gaps = 1/99 (1%) Frame = +2 Query: 185 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA-HTQAEQKRRDAIKKGY 361 GS + + H + S EDE++ S++S K R A H Q+E+KRRD I + Sbjct: 174 GSHDNTIDDHDSVCHSRPQMEDEEEKKAGGKSSVSTKRSRAAAIHNQSERKRRDKINQRM 233 Query: 362 DSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 +LQ+LVP +TD KA++L + I+Y++ L Q Sbjct: 234 KTLQKLVPNSSKTD-------KASMLDEVIEYLKQLQAQ 265 >At3g59060.2 68416.m06584 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 444 Score = 52.8 bits (121), Expect = 1e-07 Identities = 31/82 (37%), Positives = 47/82 (57%), Gaps = 3/82 (3%) Frame = +2 Query: 242 TEDEDDSGDNKASALSFKERRR---EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASG 412 T +D + NK+S S RR E H +E++RRD I + +LQEL+P C +TD Sbjct: 234 TSTDDQTMGNKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTD--- 290 Query: 413 YKHSKAAVLQKSIDYIQYLLQQ 478 KA++L ++IDY++ L Q Sbjct: 291 ----KASILDEAIDYLKSLQMQ 308 >At3g59060.1 68416.m06583 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 442 Score = 52.8 bits (121), Expect = 1e-07 Identities = 31/82 (37%), Positives = 47/82 (57%), Gaps = 3/82 (3%) Frame = +2 Query: 242 TEDEDDSGDNKASALSFKERRR---EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASG 412 T +D + NK+S S RR E H +E++RRD I + +LQEL+P C +TD Sbjct: 234 TSTDDQTMGNKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTD--- 290 Query: 413 YKHSKAAVLQKSIDYIQYLLQQ 478 KA++L ++IDY++ L Q Sbjct: 291 ----KASILDEAIDYLKSLQMQ 308 >At2g43010.2 68415.m05338 phytochrome-interacting factor 4 (PIF4) / basic helix-loop-helix protein 9 (bHLH9) / short under red-light 2 (SRL2) identical to SP|Q8W2F3 Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (Short under red-light 2) {Arabidopsis thaliana}; supporting cDNA gi|18026965|gb|AF251694.1|AF251694 Length = 428 Score = 50.0 bits (114), Expect = 1e-06 Identities = 26/70 (37%), Positives = 42/70 (60%) Frame = +2 Query: 269 NKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKS 448 N+ S + + R E H +E++RRD I + +LQEL+P C +TD KA++L ++ Sbjct: 247 NQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSKTD-------KASILDEA 299 Query: 449 IDYIQYLLQQ 478 IDY++ L Q Sbjct: 300 IDYLKSLQLQ 309 >At2g43010.1 68415.m05337 phytochrome-interacting factor 4 (PIF4) / basic helix-loop-helix protein 9 (bHLH9) / short under red-light 2 (SRL2) identical to SP|Q8W2F3 Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (Short under red-light 2) {Arabidopsis thaliana}; supporting cDNA gi|18026965|gb|AF251694.1|AF251694 Length = 430 Score = 50.0 bits (114), Expect = 1e-06 Identities = 26/70 (37%), Positives = 42/70 (60%) Frame = +2 Query: 269 NKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKS 448 N+ S + + R E H +E++RRD I + +LQEL+P C +TD KA++L ++ Sbjct: 247 NQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSKTD-------KASILDEA 299 Query: 449 IDYIQYLLQQ 478 IDY++ L Q Sbjct: 300 IDYLKSLQLQ 309 >At1g09530.2 68414.m01069 phytochrome interacting factor 3 (PIF3) identical to phytochrome interacting factor 3 (PIF3) GI:3929585 from [Arabidopsis thaliana] Length = 524 Score = 48.0 bits (109), Expect = 4e-06 Identities = 32/102 (31%), Positives = 55/102 (53%), Gaps = 8/102 (7%) Frame = +2 Query: 197 SIQNIHQTPSSSNQNTED-EDDSGDNKASAL-------SFKERRREAHTQAEQKRRDAIK 352 S++ H + ++ED E++SGD + A S + R E H +E++RRD I Sbjct: 301 SLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRIN 360 Query: 353 KGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 + +LQEL+P C + D KA++L ++I+Y++ L Q Sbjct: 361 EKMRALQELIPNCNKVD-------KASMLDEAIEYLKSLQLQ 395 >At1g09530.1 68414.m01068 phytochrome interacting factor 3 (PIF3) identical to phytochrome interacting factor 3 (PIF3) GI:3929585 from [Arabidopsis thaliana] Length = 524 Score = 48.0 bits (109), Expect = 4e-06 Identities = 32/102 (31%), Positives = 55/102 (53%), Gaps = 8/102 (7%) Frame = +2 Query: 197 SIQNIHQTPSSSNQNTED-EDDSGDNKASAL-------SFKERRREAHTQAEQKRRDAIK 352 S++ H + ++ED E++SGD + A S + R E H +E++RRD I Sbjct: 301 SLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRIN 360 Query: 353 KGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 + +LQEL+P C + D KA++L ++I+Y++ L Q Sbjct: 361 EKMRALQELIPNCNKVD-------KASMLDEAIEYLKSLQLQ 395 >At1g69010.1 68414.m07896 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 311 Score = 46.8 bits (106), Expect = 1e-05 Identities = 29/86 (33%), Positives = 46/86 (53%) Frame = +2 Query: 221 PSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQT 400 PSS+ + D ++KASA+ R H+ EQ+RR I + + L+EL+P +Q Sbjct: 25 PSSNTTVHSNRDSKENDKASAI------RSKHSVTEQRRRSKINERFQILRELIPNSEQ- 77 Query: 401 DASGYKHSKAAVLQKSIDYIQYLLQQ 478 K A+ L + IDY+QYL ++ Sbjct: 78 -----KRDTASFLLEVIDYVQYLQEK 98 >At2g46970.1 68415.m05867 basic helix-loop-helix (bHLH) protein, putative similar to PIF3 like basic Helix Loop Helix protein (PIL1) [Arabidopsis thaliana] GI:22535492; contains Myc-type, 'helix-loop-helix' dimerization domain signature, PROSITE:PS00038 Length = 416 Score = 46.4 bits (105), Expect = 1e-05 Identities = 31/98 (31%), Positives = 49/98 (50%), Gaps = 3/98 (3%) Frame = +2 Query: 194 GSIQNIHQTPSSSNQNTEDEDDSGDNKASA---LSFKERRREAHTQAEQKRRDAIKKGYD 364 G I+ T S+N + E +D A ++ ++R E H E+KRRD K Sbjct: 191 GDIEEEESTYLSNNSDDESDDAKTQVHARTRKPVTKRKRSTEVHKLYERKRRDEFNKKMR 250 Query: 365 SLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 +LQ+L+P C YK KA++L ++I Y++ L Q Sbjct: 251 ALQDLLPNC-------YKDDKASLLDEAIKYMRTLQLQ 281 >At2g20180.2 68415.m02360 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 478 Score = 46.0 bits (104), Expect = 2e-05 Identities = 26/86 (30%), Positives = 49/86 (56%), Gaps = 1/86 (1%) Frame = +2 Query: 224 SSSNQNTEDEDDSGDNKASALSFKERRR-EAHTQAEQKRRDAIKKGYDSLQELVPTCQQT 400 +++++ +++ + S S K R E H +E+KRRD I + +LQEL+P C ++ Sbjct: 258 TTTDETESRSEETKQARVSTTSTKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNKS 317 Query: 401 DASGYKHSKAAVLQKSIDYIQYLLQQ 478 D KA++L ++I+Y++ L Q Sbjct: 318 D-------KASMLDEAIEYMKSLQLQ 336 >At2g20180.1 68415.m02359 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 407 Score = 46.0 bits (104), Expect = 2e-05 Identities = 26/86 (30%), Positives = 49/86 (56%), Gaps = 1/86 (1%) Frame = +2 Query: 224 SSSNQNTEDEDDSGDNKASALSFKERRR-EAHTQAEQKRRDAIKKGYDSLQELVPTCQQT 400 +++++ +++ + S S K R E H +E+KRRD I + +LQEL+P C ++ Sbjct: 187 TTTDETESRSEETKQARVSTTSTKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNKS 246 Query: 401 DASGYKHSKAAVLQKSIDYIQYLLQQ 478 D KA++L ++I+Y++ L Q Sbjct: 247 D-------KASMLDEAIEYMKSLQLQ 265 >At3g23690.1 68416.m02979 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 371 Score = 44.0 bits (99), Expect = 7e-05 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 12/110 (10%) Frame = +2 Query: 185 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASA---------LSFKERRREA---HTQAE 328 GS G ++ SS E D GDNK A + + RR +A H+ AE Sbjct: 147 GSKGGKRSKQDVAGSSKNGVEKCDSKGDNKDDAKPPEAPKDYIHVRARRGQATDSHSLAE 206 Query: 329 QKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 + RR+ I + LQ+LVP C + KA +L + I+Y+Q L +Q Sbjct: 207 RARREKISERMTLLQDLVPGCNRIT------GKAVMLDEIINYVQSLQRQ 250 >At2g18300.2 68415.m02134 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;supported by cDNA gi|20127067|gb|AF488597.1| Length = 337 Score = 44.0 bits (99), Expect = 7e-05 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 4/95 (4%) Frame = +2 Query: 206 NIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQ 373 N+ T +SS+ + E + +N K + + RR +A H+ AE+ RR+ I K LQ Sbjct: 156 NMGNTEASSDTSKETSKGASENQKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQ 215 Query: 374 ELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 ++VP C + KA +L + I+Y+Q L +Q Sbjct: 216 DIVPGCNKVT------GKAGMLDEIINYVQCLQRQ 244 >At2g18300.1 68415.m02133 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;supported by cDNA gi|20127067|gb|AF488597.1| Length = 335 Score = 44.0 bits (99), Expect = 7e-05 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 4/95 (4%) Frame = +2 Query: 206 NIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQ 373 N+ T +SS+ + E + +N K + + RR +A H+ AE+ RR+ I K LQ Sbjct: 156 NMGNTEASSDTSKETSKGASENQKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQ 215 Query: 374 ELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 ++VP C + KA +L + I+Y+Q L +Q Sbjct: 216 DIVPGCNKVT------GKAGMLDEIINYVQCLQRQ 244 >At4g30980.1 68417.m04397 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 310 Score = 43.6 bits (98), Expect = 9e-05 Identities = 30/98 (30%), Positives = 50/98 (51%) Frame = +2 Query: 185 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 364 GS G Q Q+ ++++ T K + + + + H+ AE+ RR+ I + Sbjct: 100 GSGGQTQT--QSQATASATTGGATAQPQTKPKVRARRGQATDPHSIAERLRRERIAERMK 157 Query: 365 SLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 SLQELVP +TD KA++L + IDY+++L Q Sbjct: 158 SLQELVPNGNKTD-------KASMLDEIIDYVKFLQLQ 188 >At1g26260.2 68414.m03204 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor GBOF-1 GI:5923912 from [Tulipa gesneriana] Length = 390 Score = 43.2 bits (97), Expect = 1e-04 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 4/93 (4%) Frame = +2 Query: 203 QNIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSL 370 Q Q+P+S+ T E D+ K + + RR +A H+ AE+ RR+ I + L Sbjct: 193 QKDEQSPTSNANKTNSEKQPSDSLKDGYIHMRARRGQATNSHSLAERVRREKISERMKFL 252 Query: 371 QELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 469 Q+LVP C + KA +L + I+Y+Q L Sbjct: 253 QDLVPGCDKVT------GKAVMLDEIINYVQSL 279 >At1g26260.1 68414.m03203 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor GBOF-1 GI:5923912 from [Tulipa gesneriana] Length = 390 Score = 43.2 bits (97), Expect = 1e-04 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 4/93 (4%) Frame = +2 Query: 203 QNIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSL 370 Q Q+P+S+ T E D+ K + + RR +A H+ AE+ RR+ I + L Sbjct: 193 QKDEQSPTSNANKTNSEKQPSDSLKDGYIHMRARRGQATNSHSLAERVRREKISERMKFL 252 Query: 371 QELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 469 Q+LVP C + KA +L + I+Y+Q L Sbjct: 253 QDLVPGCDKVT------GKAVMLDEIINYVQSL 279 >At4g36540.2 68417.m05189 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 302 Score = 41.9 bits (94), Expect = 3e-04 Identities = 30/87 (34%), Positives = 44/87 (50%), Gaps = 3/87 (3%) Frame = +2 Query: 227 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQ 397 S+ NTE + K + + RR EA H+ AE+ RR+ I K LQ++VP C + Sbjct: 122 SNMSNTETSSEI--QKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNK 179 Query: 398 TDASGYKHSKAAVLQKSIDYIQYLLQQ 478 KA +L + I+Y+Q L QQ Sbjct: 180 VT------GKAGMLDEIINYVQSLQQQ 200 >At4g36540.1 68417.m05188 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 304 Score = 41.9 bits (94), Expect = 3e-04 Identities = 30/87 (34%), Positives = 44/87 (50%), Gaps = 3/87 (3%) Frame = +2 Query: 227 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQ 397 S+ NTE + K + + RR EA H+ AE+ RR+ I K LQ++VP C + Sbjct: 122 SNMSNTETSSEI--QKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNK 179 Query: 398 TDASGYKHSKAAVLQKSIDYIQYLLQQ 478 KA +L + I+Y+Q L QQ Sbjct: 180 VT------GKAGMLDEIINYVQSLQQQ 200 >At4g36930.1 68417.m05235 basic helix-loop-helix (bHLH) protein SPATULA (SPT) identical to SPATULA (SPT) GI:11245493 from [Arabidopsis thaliana] Length = 373 Score = 41.5 bits (93), Expect = 4e-04 Identities = 31/104 (29%), Positives = 53/104 (50%), Gaps = 3/104 (2%) Frame = +2 Query: 176 SRCGSSGSIQNIHQTPSSSN-QNTEDEDDSGDNKASALSFKERRR--EAHTQAEQKRRDA 346 S G+SG+ + + S + DE S + S+ S +R R E H +E++RR Sbjct: 153 SSVGASGNETDEYDCESEEGGEAVVDEAPSSKSGPSSRSSSKRCRAAEVHNLSEKRRRSR 212 Query: 347 IKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 I + +LQ L+P +TD KA++L ++I+Y++ L Q Sbjct: 213 INEKMKALQSLIPNSNKTD-------KASMLDEAIEYLKQLQLQ 249 >At2g24260.1 68415.m02898 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 350 Score = 41.1 bits (92), Expect = 5e-04 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 8/106 (7%) Frame = +2 Query: 185 GSSGSIQNIH-QTPSSSNQNTEDEDDSGDNKA----SALSFKERRREA---HTQAEQKRR 340 GS G + N QT + + +G A S + RR +A H+ AE+ RR Sbjct: 98 GSGGGLMNQQGQTQTQTQPQASASTATGGTVAAPPQSRTKIRARRGQATDPHSIAERLRR 157 Query: 341 DAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 + I + +LQELVP +TD KA++L + IDY+++L Q Sbjct: 158 ERIAERMKALQELVPNGNKTD-------KASMLDEIIDYVKFLQLQ 196 >At1g10120.1 68414.m01141 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 301 Score = 41.1 bits (92), Expect = 5e-04 Identities = 31/101 (30%), Positives = 46/101 (45%), Gaps = 3/101 (2%) Frame = +2 Query: 185 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKK 355 G+ S + S N E K + + + RR +A H+ AE+ RR+ I + Sbjct: 106 GNDQSQKKHKNDQSKETVNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISE 165 Query: 356 GYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 LQELVP C + KA +L + I+Y+Q L QQ Sbjct: 166 RMRLLQELVPGCNKIT------GKAVMLDEIINYVQSLQQQ 200 >At1g03040.1 68414.m00276 basic helix-loop-helix (bHLH) family protein component of the pyruvate dehydrogenase complex E3, contains PF|00010 helix-loop-helix DNA-binding domain. ESTs gb|T45640 and gb|T22783 come from this gene Length = 302 Score = 40.7 bits (91), Expect = 6e-04 Identities = 22/57 (38%), Positives = 36/57 (63%) Frame = +2 Query: 308 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 + H+ AE+ RR+ I + SLQELVPT +TD +AA++ + +DY+++L Q Sbjct: 153 DPHSIAERLRRERIAERIRSLQELVPTVNKTD-------RAAMIDEIVDYVKFLRLQ 202 >At4g28790.2 68417.m04116 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 340 Score = 39.9 bits (89), Expect = 0.001 Identities = 27/82 (32%), Positives = 43/82 (52%) Frame = +2 Query: 233 NQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASG 412 NQ TE+ DS +K S R H +E++RR I + +LQEL+P C +TD Sbjct: 261 NQGTEEARDSTSSKRS------RAAIMHKLSERRRRQKINEMMKALQELLPRCTKTD--- 311 Query: 413 YKHSKAAVLQKSIDYIQYLLQQ 478 ++++L I+Y++ L Q Sbjct: 312 ----RSSMLDDVIEYVKSLQSQ 329 >At4g28790.1 68417.m04117 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 413 Score = 39.9 bits (89), Expect = 0.001 Identities = 27/82 (32%), Positives = 43/82 (52%) Frame = +2 Query: 233 NQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASG 412 NQ TE+ DS +K S R H +E++RR I + +LQEL+P C +TD Sbjct: 261 NQGTEEARDSTSSKRS------RAAIMHKLSERRRRQKINEMMKALQELLPRCTKTD--- 311 Query: 413 YKHSKAAVLQKSIDYIQYLLQQ 478 ++++L I+Y++ L Q Sbjct: 312 ----RSSMLDDVIEYVKSLQSQ 329 >At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family protein similar to A. thaliana putative protein F6I18.110, GenBank accession number 2980768 Length = 310 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/57 (36%), Positives = 36/57 (63%) Frame = +2 Query: 308 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 + H+ AE+ RR+ I + +LQELVPT +TD +AA++ + +DY+++L Q Sbjct: 155 DPHSIAERLRRERIAERIRALQELVPTVNKTD-------RAAMIDEIVDYVKFLRLQ 204 >At5g61270.1 68418.m07689 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 366 Score = 39.1 bits (87), Expect = 0.002 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 1/85 (1%) Frame = +2 Query: 227 SSNQNTEDEDDSGDNKASALSFKERRREA-HTQAEQKRRDAIKKGYDSLQELVPTCQQTD 403 S Q+TE ++ +A + + R A H ++E++RRD I + +LQ+L+PT + D Sbjct: 141 SETQDTEGDEQETRGEAGRSNGRRGRAAAIHNESERRRRDRINQRMRTLQKLLPTASKAD 200 Query: 404 ASGYKHSKAAVLQKSIDYIQYLLQQ 478 K ++L I++++ L Q Sbjct: 201 -------KVSILDDVIEHLKQLQAQ 218 >At5g38860.1 68418.m04700 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 298 Score = 39.1 bits (87), Expect = 0.002 Identities = 19/58 (32%), Positives = 34/58 (58%) Frame = +2 Query: 305 REAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 R H++ EQ+RR I + + SL +++P Q + K KA+ L + I+YI +L ++ Sbjct: 35 RSKHSETEQRRRSKINERFQSLMDIIPQNQ----NDQKRDKASFLLEVIEYIHFLQEK 88 >At1g68920.2 68414.m07888 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 485 Score = 39.1 bits (87), Expect = 0.002 Identities = 32/100 (32%), Positives = 50/100 (50%), Gaps = 8/100 (8%) Frame = +2 Query: 203 QNIHQTPSS----SNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKG 358 +N Q+P+S SN + S D K + + RR +A H+ AE+ RR+ I + Sbjct: 268 RNDEQSPNSPGKKSNSGKQQGKQSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISER 327 Query: 359 YDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 LQ+LVP C + KA +L + I+Y+Q L +Q Sbjct: 328 MKFLQDLVPGCNKVT------GKAVMLDEIINYVQSLQRQ 361 >At1g68920.1 68414.m07887 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 486 Score = 39.1 bits (87), Expect = 0.002 Identities = 32/100 (32%), Positives = 50/100 (50%), Gaps = 8/100 (8%) Frame = +2 Query: 203 QNIHQTPSS----SNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKG 358 +N Q+P+S SN + S D K + + RR +A H+ AE+ RR+ I + Sbjct: 269 RNDEQSPNSPGKKSNSGKQQGKQSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISER 328 Query: 359 YDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 LQ+LVP C + KA +L + I+Y+Q L +Q Sbjct: 329 MKFLQDLVPGCNKVT------GKAVMLDEIINYVQSLQRQ 362 >At5g58010.1 68418.m07258 basic helix-loop-helix (bHLH) family protein bHLH transcription factor GBOF-1, Tulipa gesneriana, EMBL:AF185269; contains Pfam profile PF00010: Helix-loop-helix DNA-binding domain Length = 297 Score = 38.7 bits (86), Expect = 0.003 Identities = 22/57 (38%), Positives = 35/57 (61%) Frame = +2 Query: 308 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 + H+ AE+ RR+ I + SLQELVP +TD KA++L + I+Y+++L Q Sbjct: 108 DPHSIAERLRRERIAERMKSLQELVPNTNKTD-------KASMLDEIIEYVRFLQLQ 157 >At4g28800.1 68417.m04118 bHLH family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 478 Score = 38.7 bits (86), Expect = 0.003 Identities = 18/64 (28%), Positives = 37/64 (57%), Gaps = 2/64 (3%) Frame = +2 Query: 221 PSSSNQNTEDEDDSGDNKASALSFKERRR--EAHTQAEQKRRDAIKKGYDSLQELVPTCQ 394 P++ ++ E+ G +A + ++R R E H AE++RR+ I + +LQ+L+P C Sbjct: 227 PATESKLKAREETHGTEEARGSTSRKRSRTAEMHNLAERRRREKINEKMKTLQQLIPRCN 286 Query: 395 QTDA 406 + ++ Sbjct: 287 KVES 290 >At4g27120.2 68417.m03898 expressed protein Length = 298 Score = 38.7 bits (86), Expect = 0.003 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 3/68 (4%) Frame = +2 Query: 185 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERR---REAHTQAEQKRRDAIKK 355 G+S S N+ + S S EDED++G +A A KE++ REA QAE+ R++ Sbjct: 64 GASSSTSNVQENGSGSED--EDEDEAGGTQARASKKKEKKRQEREAQRQAEEATRESRNT 121 Query: 356 GYDSLQEL 379 D E+ Sbjct: 122 KQDWYAEM 129 >At4g27120.1 68417.m03897 expressed protein Length = 298 Score = 38.7 bits (86), Expect = 0.003 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 3/68 (4%) Frame = +2 Query: 185 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERR---REAHTQAEQKRRDAIKK 355 G+S S N+ + S S EDED++G +A A KE++ REA QAE+ R++ Sbjct: 64 GASSSTSNVQENGSGSED--EDEDEAGGTQARASKKKEKKRQEREAQRQAEEATRESRNT 121 Query: 356 GYDSLQEL 379 D E+ Sbjct: 122 KQDWYAEM 129 >At5g08130.1 68418.m00948 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 409 Score = 38.3 bits (85), Expect = 0.003 Identities = 20/58 (34%), Positives = 32/58 (55%) Frame = +2 Query: 305 REAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 R H+ EQ+RR I + L++L+P Q K KA+ L + I+YIQ+L ++ Sbjct: 158 RSKHSATEQRRRSKINDRFQMLRQLIPNSDQ------KRDKASFLLEVIEYIQFLQEK 209 >At3g07340.1 68416.m00875 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 456 Score = 38.3 bits (85), Expect = 0.003 Identities = 30/103 (29%), Positives = 51/103 (49%), Gaps = 9/103 (8%) Frame = +2 Query: 197 SIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKE------RRREA---HTQAEQKRRDAI 349 S + I + S + + +++GD S +K+ RR +A H+ AE+ RR+ I Sbjct: 221 SSKEIEEKEDSDPKRCKKSEENGDKTKSIDPYKDYIHVRARRGQATDSHSLAERVRREKI 280 Query: 350 KKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 + LQ+LVP C + KA +L + I+Y+Q L +Q Sbjct: 281 SERMKLLQDLVPGCNKVT------GKALMLDEIINYVQSLQRQ 317 >At4g37850.1 68417.m05354 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 328 Score = 37.9 bits (84), Expect = 0.004 Identities = 22/82 (26%), Positives = 45/82 (54%) Frame = +2 Query: 233 NQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASG 412 +Q +++ + G +A S + + H AE+KRR+ + + + +L LVP ++ D Sbjct: 126 HQKSDEFNRKGTKRAQPFSRNQSNAQDHIIAERKRREKLTQRFVALSALVPGLKKMD--- 182 Query: 413 YKHSKAAVLQKSIDYIQYLLQQ 478 KA+VL ++ +I+YL ++ Sbjct: 183 ----KASVLGDALKHIKYLQER 200 >At4g34530.1 68417.m04907 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 335 Score = 37.9 bits (84), Expect = 0.004 Identities = 31/104 (29%), Positives = 50/104 (48%), Gaps = 6/104 (5%) Frame = +2 Query: 185 GSSGSIQNI-HQTPSSSNQNTEDEDDSGDN--KASALSFKERRREA---HTQAEQKRRDA 346 GS+ SI+ + H+ N + D K + + RR +A H+ AE+ RR+ Sbjct: 134 GSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYIHVRARRGQATDSHSIAERVRREK 193 Query: 347 IKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 I + LQ+LVP C + KA +L + I+Y+Q L +Q Sbjct: 194 ISERMKFLQDLVPGCDKIT------GKAGMLDEIINYVQSLQRQ 231 >At1g02340.1 68414.m00180 long hypocotyl in far-red 1 (HFR1) / reduced phytochrome signaling (REP1) / basic helix-loop-helix FBI1 protein (FBI1) / reduced sensitivity to far-red light (RSF1) / bHLH protein 26 (BHLH026) (BHLH26) identical to SP|Q9FE22 Long hypocotyl in far-red 1 (bHLH-like protein HFR1) (Reduced phytochrome signaling) (Basic helix-loop-helix FBI1 protein) (Reduced sensitivity to far-red light) [Arabidopsis thaliana] Length = 292 Score = 37.5 bits (83), Expect = 0.006 Identities = 24/93 (25%), Positives = 43/93 (46%) Frame = +2 Query: 200 IQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQEL 379 ++N H+ P DD + + R+ + ++K + ++K LQ+L Sbjct: 105 LRNKHENPKKRRIQVLSSDDESEEFTREVPSVTRKGSKRRRRDEKMSNKMRK----LQQL 160 Query: 380 VPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 VP C +TD K +VL K+I+Y++ L Q Sbjct: 161 VPNCHKTD-------KVSVLDKTIEYMKNLQLQ 186 >At5g67110.1 68418.m08461 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 210 Score = 37.1 bits (82), Expect = 0.008 Identities = 26/99 (26%), Positives = 52/99 (52%), Gaps = 2/99 (2%) Frame = +2 Query: 188 SSGSIQNIHQTPSSSNQNTE--DEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGY 361 S G++ ++ S + Q+ + SG + ++L + + H +E+KRR I + Sbjct: 55 SGGAVSSVGYGVSETGQDKYAFEHKRSGAKQRNSLK-RNIDAQFHNLSEKKRRSKINEKM 113 Query: 362 DSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 +LQ+L+P +TD KA++L ++I+Y++ L Q Sbjct: 114 KALQKLIPNSNKTD-------KASMLDEAIEYLKQLQLQ 145 >At1g59640.2 68414.m06708 basic helix-loop-helix (bHLH) family protein Length = 343 Score = 37.1 bits (82), Expect = 0.008 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 3/87 (3%) Frame = +2 Query: 227 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQ 397 S TE + + + + RR +A H+ AE+ RR+ I + LQ+LVP C + Sbjct: 115 SLGTETEQKKQQMEPTKDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNK 174 Query: 398 TDASGYKHSKAAVLQKSIDYIQYLLQQ 478 KA VL + I+YIQ L +Q Sbjct: 175 V------IGKALVLDEIINYIQSLQRQ 195 >At1g59640.1 68414.m06707 basic helix-loop-helix (bHLH) family protein Length = 264 Score = 37.1 bits (82), Expect = 0.008 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 3/87 (3%) Frame = +2 Query: 227 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQ 397 S TE + + + + RR +A H+ AE+ RR+ I + LQ+LVP C + Sbjct: 115 SLGTETEQKKQQMEPTKDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNK 174 Query: 398 TDASGYKHSKAAVLQKSIDYIQYLLQQ 478 KA VL + I+YIQ L +Q Sbjct: 175 V------IGKALVLDEIINYIQSLQRQ 195 >At3g57800.2 68416.m06443 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain; supported by full-length cDNA gi:20127059 Length = 379 Score = 36.7 bits (81), Expect = 0.010 Identities = 24/85 (28%), Positives = 43/85 (50%) Frame = +2 Query: 224 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTD 403 SS+ +N E++ + + + ++H+ AE+ RR+ I LQELVP C + Sbjct: 185 SSTKKNKSSEENEKLPYVHVRARRGQATDSHSLAERARREKINARMKLLQELVPGCDKIQ 244 Query: 404 ASGYKHSKAAVLQKSIDYIQYLLQQ 478 + A VL + I+++Q L +Q Sbjct: 245 GT------ALVLDEIINHVQSLQRQ 263 >At2g22750.1 68415.m02697 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 304 Score = 36.7 bits (81), Expect = 0.010 Identities = 21/69 (30%), Positives = 39/69 (56%) Frame = +2 Query: 263 GDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQ 442 G +A +L+ + + H AE+KRR+ + + + +L L+P ++ D KA+VL Sbjct: 110 GTKRAQSLTRSQSNAQDHILAERKRREKLTQRFVALSALIPGLKKMD-------KASVLG 162 Query: 443 KSIDYIQYL 469 +I +I+YL Sbjct: 163 DAIKHIKYL 171 >At5g62610.1 68418.m07857 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 281 Score = 36.3 bits (80), Expect = 0.013 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 4/110 (3%) Frame = +2 Query: 161 ICNMYSRCGSSGSIQNIHQTPSSSN-QNTEDEDDSGDNKASALSFKERRREA---HTQAE 328 +C S G GS++ +T S ++ + + + + RR +A H+ AE Sbjct: 110 LCGSESGNGD-GSMRPEGETSSGGGGSKATEQKNKPEPPKDYIHVRARRGQATDRHSLAE 168 Query: 329 QKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 + RR+ I + +LQ+++P C + KA VL + I+YIQ L +Q Sbjct: 169 RARREKISEKMTALQDIIPGCNKI------IGKALVLDEIINYIQSLQRQ 212 >At2g42300.1 68415.m05236 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 327 Score = 35.9 bits (79), Expect = 0.018 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 3/100 (3%) Frame = +2 Query: 188 SSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKG 358 SSG + + SS + + +S +K + + RR +A H+ AE+ RR+ I Sbjct: 153 SSGKRKEREKKVKSSTKKNKSSVES--DKLPYVHVRARRGQATDNHSLAERARREKINAR 210 Query: 359 YDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 LQELVP C + + A VL + I+++Q L +Q Sbjct: 211 MKLLQELVPGCDKIQGT------ALVLDEIINHVQTLQRQ 244 >At5g50915.2 68418.m06314 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 286 Score = 34.7 bits (76), Expect = 0.041 Identities = 20/57 (35%), Positives = 32/57 (56%) Frame = +2 Query: 308 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 ++H+ AE+ RR+ I + +LQ LVP C + KA +L + I+Y+Q L Q Sbjct: 145 DSHSLAERVRREKISERMRTLQNLVPGCDKVT------GKALMLDEIINYVQTLQTQ 195 >At5g50915.1 68418.m06313 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 286 Score = 34.7 bits (76), Expect = 0.041 Identities = 20/57 (35%), Positives = 32/57 (56%) Frame = +2 Query: 308 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 ++H+ AE+ RR+ I + +LQ LVP C + KA +L + I+Y+Q L Q Sbjct: 145 DSHSLAERVRREKISERMRTLQNLVPGCDKVT------GKALMLDEIINYVQTLQTQ 195 >At5g48560.1 68418.m06005 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 498 Score = 34.7 bits (76), Expect = 0.041 Identities = 20/57 (35%), Positives = 33/57 (57%) Frame = +2 Query: 308 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 ++H+ AE+ RR+ I + LQ+LVP C + KA +L + I+Y+Q L +Q Sbjct: 310 DSHSLAERVRREKIGERMKLLQDLVPGCNKVT------GKALMLDEIINYVQSLQRQ 360 >At3g57800.1 68416.m06442 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain; supported by full-length cDNA gi:20127059 Length = 426 Score = 34.3 bits (75), Expect = 0.054 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +2 Query: 224 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQ-T 400 SS+ +N E++ + + + ++H+ AE+ RR+ I LQELVP C + T Sbjct: 185 SSTKKNKSSEENEKLPYVHVRARRGQATDSHSLAERARREKINARMKLLQELVPGCDKGT 244 Query: 401 DASG 412 D G Sbjct: 245 DFGG 248 >At4g01720.1 68417.m00223 WRKY family transcription factor similar to wild oat DNA-binding protein ABF2, GenBank accession number Z48431 Length = 489 Score = 33.9 bits (74), Expect = 0.072 Identities = 20/81 (24%), Positives = 31/81 (38%) Frame = +2 Query: 185 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 364 GSSG + S ++ D DD + S L + R + D + + Y+ Sbjct: 69 GSSGFNDGLGLVNSCHGTSSNDGDDKTKTQISRLKLELERLHEENHKLKHLLDEVSESYN 128 Query: 365 SLQELVPTCQQTDASGYKHSK 427 LQ V +QT G H + Sbjct: 129 DLQRRVLLARQTQVEGLHHKQ 149 >At1g76180.1 68414.m08846 dehydrin (ERD14) identical to SP|P42763 Dehydrin ERD14 {Arabidopsis thaliana} Length = 185 Score = 32.7 bits (71), Expect = 0.17 Identities = 17/63 (26%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = +2 Query: 200 IQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGY-DSLQE 376 ++ +H++ SSS+ ++E+E G+ + K+ +++ T+ E K + KKG+ + L+E Sbjct: 71 LEKLHRSDSSSSSSSEEEGSDGEKRKK----KKEKKKPTTEVEVKEEE--KKGFMEKLKE 124 Query: 377 LVP 385 +P Sbjct: 125 KLP 127 >At1g25330.1 68414.m03143 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 223 Score = 32.7 bits (71), Expect = 0.17 Identities = 21/57 (36%), Positives = 32/57 (56%) Frame = +2 Query: 308 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 ++H+ AE+ RR+ I + LQ+LVP C + A G A +L IDY++ L Q Sbjct: 113 DSHSLAERVRREKINERLKCLQDLVPGCYK--AMG----MAVMLDVIIDYVRSLQNQ 163 >At4g17880.1 68417.m02665 basic helix-loop-helix (bHLH) family protein bHLH protein, Arabidopsis thaliana, PATCHX:E255557 Length = 589 Score = 32.3 bits (70), Expect = 0.22 Identities = 19/70 (27%), Positives = 35/70 (50%) Frame = +2 Query: 314 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQXXXXX 493 H +AE++RR+ + + + SL+ +VP + D KA++L +I YI L + Sbjct: 417 HVEAERQRREKLNQRFYSLRAVVPNVSKMD-------KASLLGDAISYISELKSKLQKAE 469 Query: 494 XXXNALRKDV 523 L+K + Sbjct: 470 SDKEELQKQI 479 >At2g40200.1 68415.m04943 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 254 Score = 31.9 bits (69), Expect = 0.29 Identities = 21/71 (29%), Positives = 35/71 (49%) Frame = +2 Query: 266 DNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQK 445 D+ + E +H AE++RRD I +L++LVP + D KAA+L Sbjct: 51 DDCVGGIEKAESLSRSHRLAEKRRRDRINSHLTALRKLVPNSDKLD-------KAALLAT 103 Query: 446 SIDYIQYLLQQ 478 I+ ++ L Q+ Sbjct: 104 VIEQVKELKQK 114 >At2g31210.1 68415.m03811 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain; PMID: 12679534 Length = 428 Score = 31.5 bits (68), Expect = 0.38 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 8/92 (8%) Frame = +2 Query: 218 TPSSSNQNTEDEDDSGDNKASALSF-KERRREAHTQ-------AEQKRRDAIKKGYDSLQ 373 T N DE+++ + + F KE RR+ + E++RR + + Y++L+ Sbjct: 175 TTQRDESNVGDENNNAQFDSGIIEFSKEIRRKGRGKRKNKPFTTERERRCHLNERYEALK 234 Query: 374 ELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 469 L+P+ + D +A++LQ IDYI L Sbjct: 235 LLIPSPSKGD-------RASILQDGIDYINEL 259 >At1g50410.1 68414.m05650 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to transcription factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 981 Score = 31.5 bits (68), Expect = 0.38 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +2 Query: 152 ITDICNMYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDN 271 + DI S G+S S QN Q SSS Q +D+DD D+ Sbjct: 770 VLDILQSLSNQGTSNSTQN-GQMASSSQQPNDDDDDDDDD 808 >At1g27740.1 68414.m03390 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 258 Score = 31.5 bits (68), Expect = 0.38 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 11/98 (11%) Frame = +2 Query: 218 TPSSSNQNTED----EDDSGDNKASALSFKERRREAHTQAE-------QKRRDAIKKGYD 364 T SN N D + S D KAS S K + R A +KRR+ I + Sbjct: 135 TVDESNTNWVDGQSLSNSSDDEKASVTSVKGKTRATKGTATDPQSLYARKRREKINERLK 194 Query: 365 SLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 +LQ LVP + D S +L++++ Y+++L Q Sbjct: 195 TLQNLVPNGTKVDIS-------TMLEEAVHYVKFLQLQ 225 >At1g01260.1 68414.m00043 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 590 Score = 31.5 bits (68), Expect = 0.38 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 4/76 (5%) Frame = +2 Query: 254 DDSGDNKASALSFKER--RREA--HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKH 421 D+SG+N+ + R EA H +AE++RR+ + + + +L+ +VP + D Sbjct: 410 DESGNNRPRKRGRRPANGRAEALNHVEAERQRREKLNQRFYALRSVVPNISKMD------ 463 Query: 422 SKAAVLQKSIDYIQYL 469 KA++L ++ YI L Sbjct: 464 -KASLLGDAVSYINEL 478 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 31.1 bits (67), Expect = 0.51 Identities = 14/77 (18%), Positives = 40/77 (51%) Frame = +2 Query: 215 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQ 394 ++ + ++ ED+ + DNK+ ++ ++ H +++ ++++ KK + L++ + Sbjct: 1072 ESENHKSKKKEDKKEHEDNKSMKKEEDKKEKKKHEESKSRKKEEDKKDMEKLEDQNSNKK 1131 Query: 395 QTDASGYKHSKAAVLQK 445 + D + K S+ L K Sbjct: 1132 KEDKNEKKKSQHVKLVK 1148 >At3g20640.1 68416.m02612 ethylene-responsive protein -related contains similarity to ethylene-inducible ER33 protein [Lycopersicon esculentum] gi|5669656|gb|AAD46413 Length = 454 Score = 31.1 bits (67), Expect = 0.51 Identities = 23/85 (27%), Positives = 41/85 (48%) Frame = +2 Query: 224 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTD 403 S ++ +E G N + + + A KR++ + +LQ+LV +TD Sbjct: 309 SEIRDSSSNEVKRGGNDHQPAAKRAKSEAASPSPAFKRKEKMGDRIAALQQLVSPFGKTD 368 Query: 404 ASGYKHSKAAVLQKSIDYIQYLLQQ 478 A A+VL ++I+YI++L QQ Sbjct: 369 A-------ASVLSEAIEYIKFLHQQ 386 >At1g61660.2 68414.m06950 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 347 Score = 31.1 bits (67), Expect = 0.51 Identities = 25/97 (25%), Positives = 48/97 (49%), Gaps = 6/97 (6%) Frame = +2 Query: 206 NIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKR------RDAIKKGYDS 367 N TP + ED+ + +A + S K R ++ + A++ R K ++ Sbjct: 227 NFVTTPQIISTRLEDKTKNLKTRAQSESLK-RAKDNESAAKKPRVTTPSPLPTFKVRKEN 285 Query: 368 LQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 L++ + + QQ + K A+VLQ++I+YI++L Q Sbjct: 286 LRDQITSLQQLVSPFGKTDTASVLQEAIEYIKFLHDQ 322 >At1g61660.1 68414.m06949 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 393 Score = 31.1 bits (67), Expect = 0.51 Identities = 25/97 (25%), Positives = 48/97 (49%), Gaps = 6/97 (6%) Frame = +2 Query: 206 NIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKR------RDAIKKGYDS 367 N TP + ED+ + +A + S K R ++ + A++ R K ++ Sbjct: 227 NFVTTPQIISTRLEDKTKNLKTRAQSESLK-RAKDNESAAKKPRVTTPSPLPTFKVRKEN 285 Query: 368 LQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 L++ + + QQ + K A+VLQ++I+YI++L Q Sbjct: 286 LRDQITSLQQLVSPFGKTDTASVLQEAIEYIKFLHDQ 322 >At1g25310.1 68414.m03141 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 145 Score = 31.1 bits (67), Expect = 0.51 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = +2 Query: 317 TQAEQKRRDAIKKGYDSLQELVPTCQQTD 403 T ++KRR+ I++ ++L+E+ P C Q+D Sbjct: 72 TLLKKKRRERIRRQLETLKEITPNCPQSD 100 >At1g22450.1 68414.m02806 cytochrome c oxidase subunit 6b, putative (COX6b) nearly identical to subunit 6b of cytochrome c oxidase [Arabidopsis thaliana] GI:6518353 Length = 191 Score = 31.1 bits (67), Expect = 0.51 Identities = 20/73 (27%), Positives = 35/73 (47%) Frame = +2 Query: 215 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQ 394 QTPS S Q +++ D A + KE E TQAE+ + + K+ ++E V + Sbjct: 8 QTPSLSEQYHLEKEVKQDTSAKPVEVKEVAPEVTTQAEEVKTEQAKE-ESPVEEAVSVVE 66 Query: 395 QTDASGYKHSKAA 433 + S + ++ A Sbjct: 67 EKSESAPESTEVA 79 >At5g46760.1 68418.m05760 basic helix-loop-helix (bHLH) family protein Length = 592 Score = 30.3 bits (65), Expect = 0.89 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = +2 Query: 314 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 469 H +AE++RR+ + + + SL+ +VP + D KA++L +I YI L Sbjct: 416 HVEAERQRREKLNQRFYSLRAVVPNVSKMD-------KASLLGDAISYINEL 460 >At5g41315.1 68418.m05021 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;annotation temporarily based on supporting cDNA gi|17224394|gb|AF246291.1|AF246291 Length = 637 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/52 (26%), Positives = 31/52 (59%) Frame = +2 Query: 314 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 469 H E+KRR+ + + + +L++++P+ + D K ++L +I+Y+Q L Sbjct: 442 HAVLEKKRREKLNERFMTLRKIIPSINKID-------KVSILDDTIEYLQEL 486 >At5g37800.1 68418.m04552 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 307 Score = 30.3 bits (65), Expect = 0.89 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 1/107 (0%) Frame = +2 Query: 161 ICNMYSRCGSSGSIQNIHQTP-SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKR 337 I N+ SR S+ ++ P + N + SG N ++ + A + R Sbjct: 160 IVNIGSRHESTSPKLAGNKRPFTGENTQLSKKPSSGTNGKIKPKATTSPKDPQSLAAKNR 219 Query: 338 RDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 R+ I + LQELVP G K +L+K+I Y+++L Q Sbjct: 220 RERISERLKVLQELVPN-------GTKVDLVTMLEKAIGYVKFLQVQ 259 >At4g29930.1 68417.m04258 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 254 Score = 30.3 bits (65), Expect = 0.89 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = +2 Query: 323 AEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 +E+ RR + + +L+ +VP + D KA+V++ SIDY+Q L+ Q Sbjct: 58 SERNRRQKLNQRLFALRSVVPNISKLD-------KASVIKDSIDYMQELIDQ 102 >At4g00870.1 68417.m00118 basic helix-loop-helix (bHLH) family protein similar to the myc family of helix-loop-helix transcription factors; contains Pfam profile PF00010: Helix-loop-helix DNA-binding domain; PMID: 12679534 Length = 423 Score = 30.3 bits (65), Expect = 0.89 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 3/66 (4%) Frame = +2 Query: 281 ALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSI 451 A + KE+ A H +AE++RR+ + + +L+ +VP + D KA++L ++ Sbjct: 236 AAATKEKHHPAVLSHVEAEKQRREKLNHRFYALRAIVPKVSRMD-------KASLLSDAV 288 Query: 452 DYIQYL 469 YI+ L Sbjct: 289 SYIESL 294 >At3g19510.1 68416.m02472 homeobox protein (HAT 3.1) identical to homeotic protein HAT 3.1 (GI:11994474) [Arabidopsis thaliana] Length = 723 Score = 30.3 bits (65), Expect = 0.89 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = +2 Query: 221 PSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELV 382 P N N DED S DN+ S T A + ++ K+G D +++++ Sbjct: 377 PDCLNDNENDEDGSDDNEESENEDGSSDETEFTSASDEMIESFKEGKDIMKDVM 430 >At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 566 Score = 30.3 bits (65), Expect = 0.89 Identities = 16/55 (29%), Positives = 33/55 (60%) Frame = +2 Query: 314 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 H +AE++RR+ + + + +L+ +VP + D KA++L +I YI+ L ++ Sbjct: 396 HVEAERQRREKLNQRFYALRSVVPNISKMD-------KASLLGDAISYIKELQEK 443 >At2g44200.1 68415.m05500 expressed protein Length = 493 Score = 30.3 bits (65), Expect = 0.89 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +2 Query: 212 HQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIK 352 HQ SSS Q ++ E+DSG+ S ++ H + ++ R ++ Sbjct: 191 HQKQSSSRQRSDSEEDSGEENNGRKSHHQKTSGTHDRHYERPRSDLE 237 >At2g14760.1 68415.m01667 basic helix-loop-helix protein / bHLH protein contains Pfam profile PF00010: Helix-loop-helix DNA-binding domain; PMID: 12679534; putative bHLH084 transcription factor Length = 328 Score = 30.3 bits (65), Expect = 0.89 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 5/81 (6%) Frame = +2 Query: 251 EDDSGDNKASALSFKERR-REAHTQAE----QKRRDAIKKGYDSLQELVPTCQQTDASGY 415 ++D D+KA L+ K R R A T + +KRR+ I + LQ LVP + D S Sbjct: 222 KEDGEDSKALNLNGKTRASRGAATDPQSLYARKRRERINERLRILQHLVPNGTKVDIS-- 279 Query: 416 KHSKAAVLQKSIDYIQYLLQQ 478 +L++++ Y+++L Q Sbjct: 280 -----TMLEEAVQYVKFLQLQ 295 >At1g63650.2 68414.m07202 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor (JAF13) GB:AAC39455 [Petunia x hybrida]; contains Pfam profile: PF00010 Helix-loop-helix DNA-binding domain Length = 596 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/52 (26%), Positives = 31/52 (59%) Frame = +2 Query: 314 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 469 H +E+KRR+ + + + +L+ ++P+ + D K ++L +I+Y+Q L Sbjct: 406 HALSEKKRREKLNERFMTLRSIIPSISKID-------KVSILDDTIEYLQDL 450 >At1g63650.1 68414.m07201 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor (JAF13) GB:AAC39455 [Petunia x hybrida]; contains Pfam profile: PF00010 Helix-loop-helix DNA-binding domain Length = 596 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/52 (26%), Positives = 31/52 (59%) Frame = +2 Query: 314 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 469 H +E+KRR+ + + + +L+ ++P+ + D K ++L +I+Y+Q L Sbjct: 406 HALSEKKRREKLNERFMTLRSIIPSISKID-------KVSILDDTIEYLQDL 450 >At3g29075.1 68416.m03637 glycine-rich protein Length = 294 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/61 (26%), Positives = 30/61 (49%) Frame = +2 Query: 185 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 364 G G I++ + PS ED+ D G K S + + ++ + ++K++D K G + Sbjct: 121 GYGGRIESDYVKPSYGGH--EDDGDDGHKKHSGKDYDDGDEKSKKKEKEKKKDKKKDGNN 178 Query: 365 S 367 S Sbjct: 179 S 179 >At3g25710.1 68416.m03199 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 344 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/57 (28%), Positives = 34/57 (59%) Frame = +2 Query: 308 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 ++H++AE++RR+ I L+ ++P +TD KA++L + I +++ L +Q Sbjct: 134 KSHSEAERRRRERINTHLAKLRSILPNTTKTD-------KASLLAEVIQHMKELKRQ 183 >At1g68810.1 68414.m07866 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 368 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/57 (26%), Positives = 34/57 (59%) Frame = +2 Query: 308 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 ++H++AE++RR+ I L+ ++P +TD KA++L + I +++ L ++ Sbjct: 176 KSHSEAERRRRERINNHLAKLRSILPNTTKTD-------KASLLAEVIQHVKELKRE 225 >At5g63720.1 68418.m07998 hypothetical protein Length = 492 Score = 29.1 bits (62), Expect = 2.0 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Frame = +2 Query: 215 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGY-----DSLQEL 379 QTPS++ +EDE+ S + S + E TQAE + Y DS+ E+ Sbjct: 272 QTPSATGSESEDEEVSTSQEYSGETGSSSGSEWETQAENDTESKSESSYPPQNDDSVSEV 331 Query: 380 VPTCQQTD 403 + TD Sbjct: 332 STSPPHTD 339 >At5g43650.1 68418.m05335 basic helix-loop-helix (bHLH) family protein similar to unknown protein (pir||T04030) Length = 247 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/68 (25%), Positives = 35/68 (51%) Frame = +2 Query: 266 DNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQK 445 + K + ++ ++ R H E+ RR+ K+ Y +L L+P + D K ++++K Sbjct: 74 EEKKNTVAPEKERSRRHMLKERTRREKQKQSYLALHSLLPFATKND-------KNSIVEK 126 Query: 446 SIDYIQYL 469 ++D I L Sbjct: 127 AVDEIAKL 134 >At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1794 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/61 (27%), Positives = 21/61 (34%) Frame = +2 Query: 239 NTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYK 418 N D D G K + +ER RE EQ DA S E + G+ Sbjct: 20 NNNDNSDKGKEKEHDVRIRERERERDRAREQLNMDAAAAAARSADEDDDNDSEDGNGGFM 79 Query: 419 H 421 H Sbjct: 80 H 80 >At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1888 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/61 (27%), Positives = 21/61 (34%) Frame = +2 Query: 239 NTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYK 418 N D D G K + +ER RE EQ DA S E + G+ Sbjct: 93 NNNDNSDKGKEKEHDVRIRERERERDRAREQLNMDAAAAAARSADEDDDNDSEDGNGGFM 152 Query: 419 H 421 H Sbjct: 153 H 153 >At2g45130.1 68415.m05616 SPX (SYG1/Pho81/XPR1) domain-containing protein weak similarity to NUC-2 [Neurospora crassa] GI:1399532, xenotropic and polytropic murine leukemia virus receptor [Mus musculus castaneus] GI:6093320; contains Pfam profile PF03105: SPX domain Length = 245 Score = 29.1 bits (62), Expect = 2.0 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 6/89 (6%) Frame = +3 Query: 123 DKILRFQLYKSLIYATCTLGVVAVGLYKTSIKLRRLLIKIQKTKMTVEIIRHRHLVLKKG 302 DK LR++ K+LI + + + VGL I Q+ II H+ L + Sbjct: 20 DKFLRYKELKNLISSPAPVESIFVGLLNAEIDKFNAFFVEQEEDF---IIHHKELQYR-- 74 Query: 303 EEKLTPKQNRNEEM------PLRKDMIHF 371 ++L K N+EM +RKD+++F Sbjct: 75 IQRLVEKCGHNDEMSRENISEIRKDIVNF 103 >At1g66470.1 68414.m07551 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 298 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = +2 Query: 305 REAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 ++ + A + RR+ I + LQELVP G K +L+K+I Y+++L Q Sbjct: 203 KDPQSLAAKNRRERISERLKILQELVPN-------GTKVDLVTMLEKAISYVKFLQVQ 253 >At1g12860.1 68414.m01494 basic helix-loop-helix (bHLH) family protein / F-box family protein contains Pfam profiles: PF00646 F-box domain, PF00010 helix-loop-helix DNA-binding domain Length = 828 Score = 29.1 bits (62), Expect = 2.0 Identities = 22/83 (26%), Positives = 40/83 (48%) Frame = +2 Query: 230 SNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDAS 409 S N E +D + +N K+ + AE++RR + L+ +VP + D Sbjct: 621 SGLNYESDDHNTNNNKGK---KKGMPAKNLMAERRRRKKLNDRLYMLRSVVPKISKMD-- 675 Query: 410 GYKHSKAAVLQKSIDYIQYLLQQ 478 +A++L +IDY++ LLQ+ Sbjct: 676 -----RASILGDAIDYLKELLQR 693 >At4g16430.1 68417.m02487 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 467 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = +2 Query: 302 RREA--HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYI 460 R EA H +AE++RR+ + + + +L+ +VP + D KA++L +I YI Sbjct: 315 REEALNHVEAERQRREKLNQRFYALRAVVPNISKMD-------KASLLADAITYI 362 >At3g30725.1 68416.m03909 expressed protein ; expression supported by MPSS Length = 111 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +2 Query: 212 HQTPSSSNQNT--EDEDDSGDNKASALS 289 HQ PSSS+ N ++EDD GD A ++ Sbjct: 39 HQKPSSSSNNNHMDEEDDVGDKDAKPIT 66 >At2g22770.1 68415.m02701 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 314 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = +2 Query: 314 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 H AE+KRR + + +L L+P ++TD KA VL+ +I +++ L ++ Sbjct: 127 HVLAERKRRQKLNERLIALSALLPGLKKTD-------KATVLEDAIKHLKQLQER 174 >At2g20310.1 68415.m02372 expressed protein Length = 430 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 155 TDICNMYSRCGSSGSIQNIHQTPSSSNQNTEDEDD 259 TDI + S G + + ++ P+SSNQ ED+DD Sbjct: 45 TDIVEVLSEV--RGGVNSQYRKPNSSNQALEDDDD 77 >At2g06210.2 68415.m00683 phosphoprotein-related low similarity to phosphoprotein from Mus musculus GI:1236239; contains Pfam profile PF00515 TPR Domain Length = 852 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +2 Query: 218 TPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPT 388 TP S+ + EDD G++K S ERRR+ + +K + + + Y+ +E T Sbjct: 691 TPGSNKRKDRVEDDDGESKPS-----ERRRKKGGKRRKKDKSSRARHYEDDEEEAAT 742 >At2g06210.1 68415.m00684 phosphoprotein-related low similarity to phosphoprotein from Mus musculus GI:1236239; contains Pfam profile PF00515 TPR Domain Length = 1064 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +2 Query: 218 TPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPT 388 TP S+ + EDD G++K S ERRR+ + +K + + + Y+ +E T Sbjct: 903 TPGSNKRKDRVEDDDGESKPS-----ERRRKKGGKRRKKDKSSRARHYEDDEEEAAT 954 >At3g30775.1 68416.m03933 proline oxidase, mitochondrial / osmotic stress-responsive proline dehydrogenase (POX) (PRO1) (ERD5) nearly identical to SP|P92983 Proline oxidase, mitochondrial precursor (EC 1.5.3.-) (Osmotic stress- induced proline dehydrogenase) [Arabidopsis thaliana]; identical to cDNA proline oxidase precursor GI:1817543 Length = 499 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/48 (27%), Positives = 28/48 (58%) Frame = +2 Query: 323 AEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQY 466 AE++R ++ + +QE+ CQ+++ ++ +LQ +IDY+ Y Sbjct: 252 AEEERE--LEAAHGRIQEICRKCQESNVPLLIDAEDTILQPAIDYMAY 297 >At2g31730.1 68415.m03874 ethylene-responsive protein, putative similar to ethylene-inducible ER33 protein [Lycopersicon esculentum] gi|5669656|gb|AAD46413 Length = 153 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 5/76 (6%) Frame = +2 Query: 266 DNKASALSFKERRREAHTQAE-----QKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKA 430 + K + S ++ + + H ++ ++R+D + + +LQ+LV +TD A Sbjct: 13 ETKRNVYSLEDNKIKRHKSSDLSFSSKERKDKLAERISALQQLVSPYGKTDT-------A 65 Query: 431 AVLQKSIDYIQYLLQQ 478 +VL + + YIQ+L +Q Sbjct: 66 SVLLEGMQYIQFLQEQ 81 >At2g28160.1 68415.m03420 basic helix-loop-helix (bHLH) family protein Length = 318 Score = 28.3 bits (60), Expect = 3.6 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 8/86 (9%) Frame = +2 Query: 245 EDEDD--SGDNKASALSFKERRREAHTQ------AEQKRRDAIKKGYDSLQELVPTCQQT 400 EDE+D GD+ ++ + + R+ T +E++RR +K +L+ LVP + Sbjct: 101 EDEEDYNDGDDSSATTTNNDGTRKTKTDRSRTLISERRRRGRMKDKLYALRSLVPNITKM 160 Query: 401 DASGYKHSKAAVLQKSIDYIQYLLQQ 478 D KA+++ ++ Y+Q L Q Sbjct: 161 D-------KASIVGDAVLYVQELQSQ 179 >At2g02480.1 68415.m00187 DNA polymerase-related weak similarity to DNA polymerase III holoenzyme tau subunit [Thermus thermophilus] GI:2583049 Length = 1218 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/88 (21%), Positives = 33/88 (37%) Frame = +2 Query: 185 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 364 GS S H S + +DD +++K+R H IK+ + Sbjct: 800 GSMPSPGTTHTGSSRRQSSRATDDDPASVSREVMAYKQRIGGLHFSKSASPASVIKRNGN 859 Query: 365 SLQELVPTCQQTDASGYKHSKAAVLQKS 448 E P + D + YK S ++ + +S Sbjct: 860 HSHEAKPFSRVIDNNCYKSSSSSQMIES 887 >At1g32640.1 68414.m04026 basic helix-loop-helix (bHLH) protein (RAP-1) identical to bHLH protein GB:CAA67885 GI:1465368 from [Arabidopsis thaliana] Length = 623 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/52 (30%), Positives = 30/52 (57%) Frame = +2 Query: 314 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 469 H +AE++RR+ + + + +L+ +VP + D KA++L +I YI L Sbjct: 453 HVEAERQRREKLNQRFYALRAVVPNVSKMD-------KASLLGDAIAYINEL 497 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/43 (27%), Positives = 26/43 (60%) Frame = +2 Query: 200 IQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAE 328 +++IH + S +Q+ +DD+G++ S+L E + E H ++ Sbjct: 593 LEHIHSS-KSEDQSVYSDDDAGESGESSLHRIEAKEEEHISSD 634 >At3g21480.1 68416.m02710 transcription activation domain-interacting protein-related contains weak similarity to Pax transcription activation domain interacting protein PTIP (GI:4336734) [Mus musculus] Length = 1045 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 233 NQNTEDEDDSGDNKASALSFKERRREAHTQAE 328 N + D DDSG + LS +E R++A+ + + Sbjct: 128 NSDLSDSDDSGSKAETVLSSEENRQDANEKVK 159 >At1g17820.1 68414.m02206 expressed protein Length = 803 Score = 27.9 bits (59), Expect = 4.7 Identities = 15/65 (23%), Positives = 33/65 (50%) Frame = +2 Query: 185 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 364 GSS + + Q+PS S ++E++D G + + ++ + E+KRR +K Sbjct: 736 GSSREVSAV-QSPSRSVASSEEDDSRGKKQGRRARMLDLGKKMGEKLEEKRRHMEEKSRQ 794 Query: 365 SLQEL 379 ++++ Sbjct: 795 IVEKM 799 >At5g41090.1 68418.m04995 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; similar to unknown protein (emb|CAB88055.1) Length = 212 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +2 Query: 206 NIHQTPSSSNQNTEDEDDSGDNKASAL-SFKER 301 N+H S S E+ED+S D A +L S KE+ Sbjct: 168 NLHIVESESESEEEEEDESVDKPAESLDSVKEK 200 >At4g33880.1 68417.m04807 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 352 Score = 27.5 bits (58), Expect = 6.2 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 7/85 (8%) Frame = +2 Query: 245 EDEDDSGDNKASALSFKERRREAHTQAE-------QKRRDAIKKGYDSLQELVPTCQQTD 403 ED D+ + AL+ + R + A +KRR+ I + LQ LVP + D Sbjct: 247 EDSSSKEDDPSKALNLNGKTRASRGAATDPQSLYARKRRERINERLRILQNLVPNGTKVD 306 Query: 404 ASGYKHSKAAVLQKSIDYIQYLLQQ 478 S +L++++ Y+++L Q Sbjct: 307 IS-------TMLEEAVHYVKFLQLQ 324 >At4g09820.1 68417.m01611 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 379 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/53 (26%), Positives = 30/53 (56%) Frame = +2 Query: 311 AHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 469 +H AE++RR+ + + + +L+ +VP + D K ++L +I Y+ +L Sbjct: 224 SHVVAERRRREKLNEKFITLRSMVPFVTKMD-------KVSILGDTIAYVNHL 269 >At4g04890.1 68417.m00712 homeobox-leucine zipper protein protodermal factor 2 (PDF2) identical to GP|14276060| protodermal factor2 (GI:14276060) Length = 743 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +3 Query: 243 QKTKMTVEIIRHRHLVLKKGEEKLTPKQNRNEE 341 ++T+M + RH + +LK +KL + NR +E Sbjct: 113 KRTQMKAQSERHENQILKSDNDKLRAENNRYKE 145 >At3g14010.1 68416.m01769 hydroxyproline-rich glycoprotein family protein similar to Mrs16p (GI:2737884) [Saccharomyces cerevisiae]; weak similarity to ataxin-2 related protein (GI:1679686) [Homo sapiens] Length = 595 Score = 27.5 bits (58), Expect = 6.2 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +2 Query: 188 SSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDA 346 SS +N+ Q+ S+S Q ++D +G N S E+RR+ + + R A Sbjct: 330 SSRKNKNVDQSCSTSKQQSKDFPAAGSN-ISESQLDEQRRKNNEEVSHNNRSA 381 >At2g41130.1 68415.m05080 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 253 Score = 27.5 bits (58), Expect = 6.2 Identities = 28/103 (27%), Positives = 46/103 (44%) Frame = +2 Query: 170 MYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAI 349 M S CGSS S + + S T +D + +AL H +AE++RR+ I Sbjct: 34 MQSLCGSSSSTSSYYPLAISGIGETMAQDRA----LAAL-------RNHKEAERRRRERI 82 Query: 350 KKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 478 + L+ ++ +TD KA +L K + ++ L QQ Sbjct: 83 NSHLNKLRNVLSCNSKTD-------KATLLAKVVQRVRELKQQ 118 >At2g03810.2 68415.m00341 18S pre-ribosomal assembly protein gar2-related contains weak similarity to Swiss-Prot:P41891 protein gar2 [Schizosaccharomyces pombe] Length = 439 Score = 27.5 bits (58), Expect = 6.2 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +2 Query: 167 NMYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHT--QAEQKRR 340 N C + G I + S NQ+ D + S L KE+R T + E ++ Sbjct: 242 NDSKECLTLGDILSREDEQKSLNQDNISSDSHEEQSPSQLQDKEKRSLETTAIETELEKT 301 Query: 341 DAIKKGYDSLQELVPTCQQ 397 + K+G + L + T Q Sbjct: 302 EEPKQGEEKLSSVSTTTSQ 320 >At2g03810.1 68415.m00340 18S pre-ribosomal assembly protein gar2-related contains weak similarity to Swiss-Prot:P41891 protein gar2 [Schizosaccharomyces pombe] Length = 439 Score = 27.5 bits (58), Expect = 6.2 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +2 Query: 167 NMYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHT--QAEQKRR 340 N C + G I + S NQ+ D + S L KE+R T + E ++ Sbjct: 242 NDSKECLTLGDILSREDEQKSLNQDNISSDSHEEQSPSQLQDKEKRSLETTAIETELEKT 301 Query: 341 DAIKKGYDSLQELVPTCQQ 397 + K+G + L + T Q Sbjct: 302 EEPKQGEEKLSSVSTTTSQ 320 >At1g77500.1 68414.m09025 expressed protein contains Pfam domains, PF04782: Protein of unknown function (DUF632) and PF04783: Protein of unknown function (DUF630) Length = 879 Score = 27.5 bits (58), Expect = 6.2 Identities = 28/110 (25%), Positives = 50/110 (45%) Frame = +3 Query: 180 GVVAVGLYKTSIKLRRLLIKIQKTKMTVEIIRHRHLVLKKGEEKLTPKQNRNEEMPLRKD 359 G ++ + T +R+LL KI +V+ I R + K +E+L P+ + L Sbjct: 584 GAESIKIDATRAAIRKLLTKIDVCIRSVDSISSR--IHKLRDEELQPQL-----IQLIHG 636 Query: 360 MIHFKSWFLPVNKLMHQAISTVKLQSFKNP*TISNTYYSKGVVXRKNEMR 509 +I L ++ QAI K++S K T+ N S ++ + E+R Sbjct: 637 LIRMWRSMLRCHQKQFQAIRESKVRSLKANTTLQNDSGSTAILDLEIELR 686 >At1g57680.2 68414.m06546 expressed protein Length = 362 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -2 Query: 406 CISLLTGRNQLLK*IISFLNGISSFLFCL 320 C+S+LT ++++ +SFL +S F FC+ Sbjct: 256 CLSVLTAADKIIFEALSFLAFLSLFCFCV 284 >At1g57680.1 68414.m06545 expressed protein Length = 362 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -2 Query: 406 CISLLTGRNQLLK*IISFLNGISSFLFCL 320 C+S+LT ++++ +SFL +S F FC+ Sbjct: 256 CLSVLTAADKIIFEALSFLAFLSLFCFCV 284 >At1g52160.1 68414.m05887 metallo-beta-lactamase family protein Length = 890 Score = 27.5 bits (58), Expect = 6.2 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +2 Query: 191 SGSIQNIHQTPSSSNQNTEDEDDSGDNKAS-ALSFKERRREAHTQAEQKRRDAIKKGYDS 367 S S+ + + SSS+ +E +G +S + F +RR E ++K+R+ +K Sbjct: 36 SFSLSTLFSSSSSSSSMENNEATNGSKSSSNSFVFNKRRAEGFDITDKKKRNLERKS--- 92 Query: 368 LQELVPT 388 Q+L PT Sbjct: 93 -QKLNPT 98 >At1g30670.1 68414.m03750 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 264 Score = 27.5 bits (58), Expect = 6.2 Identities = 18/62 (29%), Positives = 30/62 (48%) Frame = +2 Query: 293 KERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLL 472 K+R A + A +KRR I + L +L+P Q KH+ A + + Y+++L Sbjct: 132 KKRELSAQSIAARKRRRRITEKTQELGKLIPGSQ-------KHNTAEMFNAAAKYVKFLQ 184 Query: 473 QQ 478 Q Sbjct: 185 AQ 186 >At1g14687.1 68414.m01755 zinc finger homeobox family protein / ZF-HD homeobox family protein Length = 168 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 224 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIK 352 ++ +N E+EDD+ + +RRR++ AEQ R+A+K Sbjct: 82 TAEERNEEEEDDTEETSTEEKMTVQRRRKSKFTAEQ--REAMK 122 >At1g10610.1 68414.m01202 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 421 Score = 27.5 bits (58), Expect = 6.2 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 3/89 (3%) Frame = +2 Query: 215 QTPSSSNQNTEDE--DDSGDNKASA-LSFKERRREAHTQAEQKRRDAIKKGYDSLQELVP 385 QTP +D ++ D+KA+ L E + + +E+KRR+ I + L+ +VP Sbjct: 229 QTPCLIMNKEKDVVVQNANDSKANKKLLPTENFKSKNLHSERKRRERINQAMYGLRAVVP 288 Query: 386 TCQQTDASGYKHSKAAVLQKSIDYIQYLL 472 K +K + ++DYI LL Sbjct: 289 KIT-------KLNKIGIFSDAVDYINELL 310 >At5g56960.1 68418.m07110 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 466 Score = 27.1 bits (57), Expect = 8.3 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 3/94 (3%) Frame = +2 Query: 167 NMYSRCGSSGSIQNIHQTPSSSNQN--TEDEDDSGDNKASAL-SFKERRREAHTQAEQKR 337 +M +R S + NI+Q + +N T E G S + H +E+KR Sbjct: 238 SMMTRAMSFYNRLNINQRERFTRENATTHGEGSGGSGGGGRYTSGPSATQLQHMISERKR 297 Query: 338 RDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVL 439 R+ + + + +L+ L+P G K KA+VL Sbjct: 298 REKLNESFQALRSLLP-------PGTKKDKASVL 324 >At4g29550.1 68417.m04214 expressed protein contains Pfam profile PF04776: Protein of unknown function (DUF626) Length = 358 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/53 (26%), Positives = 28/53 (52%) Frame = +2 Query: 155 TDICNMYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA 313 T + + S CG + +++ P S + T+++DD+ D +S+ KE +A Sbjct: 13 TTVSHDVSSCGFISKEEWLNKHPPSGSGWTDEDDDNDDVFSSSFISKEELSDA 65 >At4g27290.1 68417.m03916 S-locus protein kinase, putative similar to S-receptor kinase gi|392557|gb|AAA62232; contains Pfam domains PF00954: S-locus glycoprotein family, PF00069: Protein kinase domain and PF01453: Lectin (probable mannose binding) Length = 772 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +2 Query: 158 DICNMYSRCGSSGSIQNIHQTPS 226 D C+ Y+ CGS GS NI+++P+ Sbjct: 278 DSCDQYTLCGSYGSC-NINESPA 299 >At3g29763.1 68416.m03760 hypothetical protein Length = 505 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +3 Query: 261 VEIIRHRHLVLKKGEEKLTPKQNRNEEMPLRKDMIH 368 ++ I ++ V+KK K PK N+ P++KD++H Sbjct: 78 LKYIAGQNEVVKKVVLKNAPKNNQMTSPPIQKDIVH 113 >At2g22760.1 68415.m02699 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 295 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/68 (25%), Positives = 32/68 (47%) Frame = +2 Query: 314 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQXXXXX 493 H AE+KRR+ + + + +L L+P ++ D K +L +I ++ L +Q Sbjct: 120 HVLAERKRREKLSEKFIALSALLPGLKKAD-------KVTILDDAISRMKQLQEQLRTLK 172 Query: 494 XXXNALRK 517 A R+ Sbjct: 173 EEKEATRQ 180 >At2g16910.1 68415.m01948 basic helix-loop-helix (bHLH) family protein Length = 571 Score = 27.1 bits (57), Expect = 8.3 Identities = 21/82 (25%), Positives = 39/82 (47%) Frame = +2 Query: 224 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTD 403 S + +DEDD K S + + + AE++RR + +L+ LVP + D Sbjct: 289 SDCSDQIDDEDDPKYKKKSGKGSQAK----NLMAERRRRKKLNDRLYALRSLVPRITKLD 344 Query: 404 ASGYKHSKAAVLQKSIDYIQYL 469 +A++L +I+Y++ L Sbjct: 345 -------RASILGDAINYVKEL 359 >At1g29570.1 68414.m03616 zinc finger protein-related contains similarity to zinc finger proteins (CCCH type) Length = 321 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +2 Query: 197 SIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKR-RDAIKKGYDSLQ 373 ++Q Q S Q E E++ + + S + +RREA +Q+R RD+I++ Q Sbjct: 186 NLQEQRQRDSIERQRREAEENLQEQRQRD-SIERQRREAQENLQQQRQRDSIERQRREAQ 244 Query: 374 E 376 E Sbjct: 245 E 245 >At1g19260.1 68414.m02396 hAT dimerisation domain-containing protein Length = 769 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +3 Query: 261 VEIIRH---RHLVLKKGEEKLTPKQNRNEEMPLRKDMIH 368 VE++++ ++ V+KK K PK N+ P++KD++H Sbjct: 207 VELLKYTAGQNEVVKKVVLKNAPKNNQMTSPPIQKDIVH 245 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,946,896 Number of Sequences: 28952 Number of extensions: 215854 Number of successful extensions: 1146 Number of sequences better than 10.0: 123 Number of HSP's better than 10.0 without gapping: 1079 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1133 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -