BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J04 (513 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 30 0.97 SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) 30 0.97 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 30 0.97 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 30 0.97 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 30 0.97 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 30 0.97 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 30 0.97 SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 30 0.97 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 30 0.97 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 30 1.3 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.3 SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 30 1.3 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.3 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.3 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.3 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 30 1.3 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 30 1.3 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 30 1.3 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50119| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_46902| Best HMM Match : GYR (HMM E-Value=1.1) 29 3.0 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_37253| Best HMM Match : Atrophin-1 (HMM E-Value=0.68) 28 3.9 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 28 3.9 SB_35314| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_11641| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-33) 28 3.9 SB_7465| Best HMM Match : RHH_1 (HMM E-Value=6.7) 28 5.2 SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_50619| Best HMM Match : RnaseH (HMM E-Value=0.89) 27 6.9 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_51888| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_51705| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 27 9.1 SB_43838| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_35269| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_34139| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 27 9.1 SB_24999| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_20893| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-23) 27 9.1 SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) 27 9.1 SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 27 9.1 SB_57935| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_54293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_50082| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_44853| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) 27 9.1 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 27 9.1 SB_26734| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_26387| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_26286| Best HMM Match : DUF963 (HMM E-Value=0.82) 27 9.1 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 27 9.1 SB_2527| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 10 LEVDGIDKLDIEF 22 >SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 28 LEVDGIDKLDIEF 40 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 53 LEVDGIDKLDIEF 65 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 25 LEVDGIDKLDIEF 37 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 10 LEVDGIDKLDIEF 22 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) Length = 163 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) Length = 216 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 24 LEVDGIDKLDIEF 36 >SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) Length = 158 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 25 LEVDGIDKLDIEF 37 >SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 28 LEVDGIDKLDIEF 40 >SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 12 LEVDGIDKLDIEF 24 >SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 24 LEVDGIDKLDIEF 36 >SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 61 LEVDGIDKLDIEF 73 >SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.97 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLDIEF Sbjct: 23 LEVDGIDKLDIEF 35 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 EFDIKLIDTVDLE Sbjct: 68 EFDIKLIDTVDLE 80 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 EFDIKLIDTVDLE Sbjct: 117 EFDIKLIDTVDLE 129 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 127 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) Length = 119 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) Length = 142 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 142 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 EFDIKLIDTVDLE Sbjct: 22 EFDIKLIDTVDLE 34 >SB_50119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 26 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 512 RIRYQAYRYRRPR 474 R+ YQAYRYRRPR Sbjct: 3 RLAYQAYRYRRPR 15 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LE+DGIDKLDIEF Sbjct: 10 LELDGIDKLDIEF 22 >SB_46902| Best HMM Match : GYR (HMM E-Value=1.1) Length = 54 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 509 IRYQAYRYRRPR 474 IR+QAYRYRRPR Sbjct: 32 IRHQAYRYRRPR 43 >SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 476 EVDGIDKLDIEF 511 EVDGIDKLDIEF Sbjct: 26 EVDGIDKLDIEF 37 >SB_37253| Best HMM Match : Atrophin-1 (HMM E-Value=0.68) Length = 1113 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 509 IRYQAYRYRRPR 474 I YQAYRYRRPR Sbjct: 591 IMYQAYRYRRPR 602 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 512 RIRYQAYRYRRPR 474 ++R+QAYRYRRPR Sbjct: 100 QLRHQAYRYRRPR 112 >SB_35314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 512 RIRYQAYRYRRPR 474 R+R QAYRYRRPR Sbjct: 19 RVRDQAYRYRRPR 31 >SB_11641| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-33) Length = 390 Score = 28.3 bits (60), Expect = 3.9 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = -1 Query: 330 ISPSFKIAYLY--ETFTSHHGREGCRI-AWVD 244 +S F++A L E + SH GREGC+ WVD Sbjct: 71 LSLPFRLAQLLNEENWPSHLGREGCQFWIWVD 102 >SB_7465| Best HMM Match : RHH_1 (HMM E-Value=6.7) Length = 71 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -2 Query: 506 RYQAYRYRRPR 474 +YQAYRYRRPR Sbjct: 57 KYQAYRYRRPR 67 >SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = +2 Query: 473 LEVDGIDKLDIEF 511 LEVDGIDKLD+++ Sbjct: 23 LEVDGIDKLDVQY 35 >SB_50619| Best HMM Match : RnaseH (HMM E-Value=0.89) Length = 724 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -2 Query: 506 RYQAYRYRRPR 474 +YQAYRYRRPR Sbjct: 431 QYQAYRYRRPR 441 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -3 Query: 511 EFDIKLIDTVDLE 473 ++DIKLIDTVDLE Sbjct: 35 KYDIKLIDTVDLE 47 >SB_51888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 87 YQAYRYRRPR 96 >SB_51705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 66 YQAYRYRRPR 75 >SB_44915| Best HMM Match : VWA (HMM E-Value=0) Length = 541 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 135 VIANPDPFFSQP-SNGPSGNYEPISTG 212 VIA PDP S+P +NG G PIS+G Sbjct: 258 VIAEPDPCLSKPCANG--GTCSPISSG 282 >SB_43838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 37 YQAYRYRRPR 46 >SB_35269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 116 YQAYRYRRPR 125 >SB_34139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 29 YQAYRYRRPR 38 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 27 YQAYRYRRPR 36 >SB_24999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 65 YQAYRYRRPR 74 >SB_20893| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-23) Length = 435 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 14 YQAYRYRRPR 23 >SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) Length = 318 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 135 VIANPDPFFSQP-SNGPSGNYEPISTG 212 VIA PDP S+P +NG G PIS+G Sbjct: 54 VIAEPDPCLSKPCANG--GTCSPISSG 78 >SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.1 bits (57), Expect = 9.1 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -2 Query: 509 IRYQAYRYRRPR 474 +++QAYRYRRPR Sbjct: 111 VKHQAYRYRRPR 122 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 533 YQAYRYRRPR 542 >SB_57935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 27 YQAYRYRRPR 36 >SB_54293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 96 YQAYRYRRPR 105 >SB_50082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 21 YQAYRYRRPR 30 >SB_44853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 43 YQAYRYRRPR 52 >SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) Length = 128 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 37 YQAYRYRRPR 46 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 135 VIANPDPFFSQP-SNGPSGNYEPISTG 212 VIA PDP S+P +NG G PIS+G Sbjct: 409 VIAEPDPCLSKPCANG--GTCSPISSG 433 >SB_26734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 94 YQAYRYRRPR 103 >SB_26387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 24 YQAYRYRRPR 33 >SB_26286| Best HMM Match : DUF963 (HMM E-Value=0.82) Length = 167 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 147 YQAYRYRRPR 156 >SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) Length = 236 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 35 YQAYRYRRPR 44 >SB_2527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 503 YQAYRYRRPR 474 YQAYRYRRPR Sbjct: 24 YQAYRYRRPR 33 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,613,070 Number of Sequences: 59808 Number of extensions: 269474 Number of successful extensions: 1201 Number of sequences better than 10.0: 113 Number of HSP's better than 10.0 without gapping: 1150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1199 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -