BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J03 (601 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_242| Best HMM Match : AFP (HMM E-Value=0.45) 30 1.2 SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) 30 1.6 SB_8632| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) 29 2.9 SB_54151| Best HMM Match : PAN (HMM E-Value=0.00084) 29 3.8 SB_55766| Best HMM Match : Keratin_B2 (HMM E-Value=1.8) 28 5.0 SB_18509| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_30304| Best HMM Match : fn3 (HMM E-Value=1.5e-32) 28 6.6 SB_12036| Best HMM Match : G_glu_transpept (HMM E-Value=0) 28 6.6 SB_53071| Best HMM Match : TSP_1 (HMM E-Value=4.3e-05) 27 8.8 SB_12713| Best HMM Match : TP2 (HMM E-Value=2.9) 27 8.8 >SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1778 Score = 33.5 bits (73), Expect = 0.13 Identities = 28/97 (28%), Positives = 41/97 (42%), Gaps = 2/97 (2%) Frame = +3 Query: 117 DDQPEQWGNSRVRRQAGALTINSDGTSGAIVKVPITGNENHKLSALGSVDLTNQMKLGAA 296 D++P V+ + TIN + +K + GN + L A S N K G Sbjct: 651 DNEPVTETIDSVKEEDSKATINCIRNNNTYIKQSVEGNNSFSLDASSS---ENVRKEGDK 707 Query: 297 TAGLAY-DNVNGHGATLTNTH-IPGFGDKLTAAGKVN 401 ++Y DN+N A T+ IPG K + KVN Sbjct: 708 DVVISYSDNMNNSKAANTDQFGIPGSDSKTGSDSKVN 744 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 165 PLAGAPWSCPTAPADHHTVRCSSQALQRART 73 P G WSC TA +H VR + + +R RT Sbjct: 1363 PAQGNAWSCGTAGRNHVRVRDGTMSGKRTRT 1393 >SB_242| Best HMM Match : AFP (HMM E-Value=0.45) Length = 147 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +1 Query: 22 CSPSYSSCLFSWSASTAGTCSLKSLATTSNSMMISRSS 135 C+PSY+ C S++++T+ TC+ +TTS + S +S Sbjct: 4 CTPSYT-CTTSYTSTTSYTCTTSYTSTTSYTSTTSYTS 40 >SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 751 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/58 (32%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = +3 Query: 333 GATLTNTHIPGFGDKLTAAGKVNLFHNDNHDLSAKAFATKNMPSIPQ-VPDFNTVGGG 503 G+T T IPG G + GK ++ N H S A P VP+ T G G Sbjct: 322 GSTTKTTKIPGPGKIHISTGKPSITDNTKHKTSPSADGKGGKGEEPTIVPEMTTQGAG 379 >SB_8632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1296 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/64 (31%), Positives = 30/64 (46%) Frame = +1 Query: 391 AKSTCSTMITMTSAQRLSLLRTCPAFLKFPISTLLVADWTTCSRTRLVHQRPPHTQTSSI 570 A +T + ++T TS Q T F T + + TT +RT+ HT+TS+ Sbjct: 50 AVATSTAVLTATSTQT-ETKTTVTTLSTFHAQTEIKTEVTTETRTKTDTATKTHTETSTA 108 Query: 571 ETTT 582 E TT Sbjct: 109 EHTT 112 >SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) Length = 685 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 277 WLVRSTEPRALSLWFSLPVIGTLTIAPEVPSELIV 173 W+V ++EP LS + +I T +I P P I+ Sbjct: 472 WVVETSEPLQLSTTIMISIITTTSILPSFPPTAII 506 >SB_54151| Best HMM Match : PAN (HMM E-Value=0.00084) Length = 326 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = -3 Query: 317 VVCQSSCSGSQLHLVSEINGAKSTELVVFVASYRYLDYST*GTVRVDSESTR 162 V C +G LV+ K + + F A YRY+ GTV V S + + Sbjct: 142 VYCDMKTNGGGWTLVTRNEPLKRSLVTTFYADYRYISTEKLGTVLVTSPAVQ 193 >SB_55766| Best HMM Match : Keratin_B2 (HMM E-Value=1.8) Length = 245 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/40 (45%), Positives = 23/40 (57%) Frame = +1 Query: 13 IRRCSPSYSSCLFSWSASTAGTCSLKSLATTSNSMMISRS 132 I RC+ Y+S + SA+T G CS+ S TSNS S S Sbjct: 43 IIRCT--YTSDSSTTSATTIGVCSIISCTYTSNSATSSGS 80 >SB_18509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 333 GATLTNTHIPGFGDKLTAAGKVNLFHNDNHDLSAKAFATKNMPS 464 G T+ P FG++ ++NLF+ +N DLSA+ +PS Sbjct: 72 GKRTTHNCKPNFGNQSNLCNQLNLFNFEN-DLSARDMPRNVVPS 114 >SB_30304| Best HMM Match : fn3 (HMM E-Value=1.5e-32) Length = 808 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +3 Query: 363 GFGDKLTAAGKVNLFHNDNHDLSAKAFAT 449 G D LT G VN+FHN DL++++ +T Sbjct: 612 GLSD-LTIDGHVNIFHNQGTDLNSQSGST 639 >SB_12036| Best HMM Match : G_glu_transpept (HMM E-Value=0) Length = 646 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/63 (25%), Positives = 32/63 (50%) Frame = +3 Query: 228 NENHKLSALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTNTHIPGFGDKLTAAGKVNLF 407 N H + G ++ + G T L+ + +G+G +LT++ FG K+ + K+ + Sbjct: 429 NRTHPVKYYGPINYRTDVTSG--TTHLSVVDADGNGVSLTSSINKYFGSKIRSK-KLGII 485 Query: 408 HND 416 +ND Sbjct: 486 YND 488 >SB_53071| Best HMM Match : TSP_1 (HMM E-Value=4.3e-05) Length = 755 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 472 KFPISTLLVADWTTCSRT 525 +FP+ T V +W TCS+T Sbjct: 216 RFPVPTWHVTEWDTCSKT 233 >SB_12713| Best HMM Match : TP2 (HMM E-Value=2.9) Length = 349 Score = 27.5 bits (58), Expect = 8.8 Identities = 20/92 (21%), Positives = 39/92 (42%) Frame = +3 Query: 231 ENHKLSALGSVDLTNQMKLGAATAGLAYDNVNGHGATLTNTHIPGFGDKLTAAGKVNLFH 410 +N+K S D ++ K A T+GLA + +G ++P +++ K N Sbjct: 83 DNYKKKKTKSKDNNSETKAKAGTSGLAKNKTKDNG----TPNLPSLFERIK---KKNNAT 135 Query: 411 NDNHDLSAKAFATKNMPSIPQVPDFNTVGGGL 506 + S + P++P++ F+T L Sbjct: 136 KNGETTSQVTINSSGTPALPKLASFDTENSSL 167 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,451,613 Number of Sequences: 59808 Number of extensions: 436505 Number of successful extensions: 1242 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1241 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -