BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J02 (333 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC115.03 ||SPBC839.18c|gfo/idh/mocA family oxidoreductase |Sch... 26 1.3 SPAC22A12.10 |||diacylglycerol cholinephosphotranferase/ diacylg... 25 4.0 SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C |Schizosacchar... 24 7.0 SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccha... 23 9.2 >SPBC115.03 ||SPBC839.18c|gfo/idh/mocA family oxidoreductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 368 Score = 26.2 bits (55), Expect = 1.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 79 CFECRRTERQSNKKTIFPNMFVY 11 C E R T QS ++ +PN+ VY Sbjct: 35 CLERRATVTQSKARSAYPNILVY 57 >SPAC22A12.10 |||diacylglycerol cholinephosphotranferase/ diacylglycerol ethanolaminesphotranferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 386 Score = 24.6 bits (51), Expect = 4.0 Identities = 5/16 (31%), Positives = 12/16 (75%) Frame = +1 Query: 40 FYCFVALCVGIQSRYL 87 F+C+V +C+G+ ++ Sbjct: 344 FFCYVGICIGVYGNFV 359 >SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C |Schizosaccharomyces pombe|chr 1|||Manual Length = 988 Score = 23.8 bits (49), Expect = 7.0 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = -1 Query: 309 VAAPSFRLSVKFKEPIAPIIF*SLPSKGYFNSSTRGTIGVERESSVR 169 + AP+ S+ P+AP + L SK + + G I + S R Sbjct: 337 INAPNSSSSISTNSPLAPTAYYKLLSKSWLSLEPVGQICISLSFSKR 383 >SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 4196 Score = 23.4 bits (48), Expect = 9.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 76 FECRRTERQSNKKTIFPN 23 FECRR + ++NK I N Sbjct: 1226 FECRRLKLENNKDEILRN 1243 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,316,950 Number of Sequences: 5004 Number of extensions: 23140 Number of successful extensions: 55 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 93942212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -