BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J02 (333 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40419-3|AAK67216.3| 260|Caenorhabditis elegans Hypothetical pr... 26 5.7 Z98866-19|CAB11556.2| 259|Caenorhabditis elegans Hypothetical p... 25 10.0 >U40419-3|AAK67216.3| 260|Caenorhabditis elegans Hypothetical protein C27F2.9 protein. Length = 260 Score = 26.2 bits (55), Expect = 5.7 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 Query: 139 IDKL*QSAWDAHGALTLNSDGTSGAGVKVPF 231 +DK Q W G S G +GAG VPF Sbjct: 143 LDKYKQPEWKLPGHTAALSFGIAGAGTGVPF 173 >Z98866-19|CAB11556.2| 259|Caenorhabditis elegans Hypothetical protein Y49E10.22 protein. Length = 259 Score = 25.4 bits (53), Expect = 10.0 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 31 RSSFYCFVALCVGIQSRYLIVSEPVYYIPTL 123 R SF C V C+ + + V E ++Y+ ++ Sbjct: 53 RKSFECHVESCISESTSKIYVIEDIFYLKSM 83 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,331,374 Number of Sequences: 27780 Number of extensions: 130008 Number of successful extensions: 292 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 12,740,198 effective HSP length: 72 effective length of database: 10,740,038 effective search space used: 408121444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -