BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_J01 (587 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16631| Best HMM Match : BCNT (HMM E-Value=2.3) 45 4e-05 SB_38212| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_55969| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_53461| Best HMM Match : Amelogenin (HMM E-Value=0.099) 37 0.011 SB_45362| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_17315| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) 36 0.032 SB_23827| Best HMM Match : DUF809 (HMM E-Value=9.1) 35 0.043 SB_2570| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 32 0.30 SB_38138| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_25003| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.53 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 31 0.53 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.70 SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) 31 0.70 SB_26644| Best HMM Match : Collagen (HMM E-Value=0) 30 1.2 SB_19164| Best HMM Match : Collagen (HMM E-Value=0.0024) 30 1.2 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_29755| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_21936| Best HMM Match : Collagen (HMM E-Value=1.1e-07) 29 2.1 SB_30949| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 29 2.8 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 29 2.8 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 29 3.7 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_8542| Best HMM Match : PT (HMM E-Value=4) 28 4.9 SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) 28 4.9 SB_17317| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_15078| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 27 8.6 SB_50003| Best HMM Match : PAN (HMM E-Value=0.044) 27 8.6 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 27 8.6 SB_6496| Best HMM Match : Collagen (HMM E-Value=0) 27 8.6 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 27 8.6 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_16631| Best HMM Match : BCNT (HMM E-Value=2.3) Length = 197 Score = 45.2 bits (102), Expect = 4e-05 Identities = 30/89 (33%), Positives = 46/89 (51%) Frame = -3 Query: 273 VDSHDYFPTFPQCLDIHGFLLKTGVH*FLQVYFHCRLQIIHQTMGIRDYLLTMDIRGYHP 94 VD DY + +DI +L K + L+ ++ + + IRDYL +DIR Y Sbjct: 72 VDIRDYL----EKVDIRDYLEKVDIRDHLE---KVDIRDYLEKVDIRDYLEKVDIRDYLE 124 Query: 93 TMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + IRDY + IRDY + + IRDY + + Sbjct: 125 KVDIRDYLEEVDIRDYLEKVDIRDYLEKV 153 Score = 45.2 bits (102), Expect = 4e-05 Identities = 30/89 (33%), Positives = 46/89 (51%) Frame = -3 Query: 273 VDSHDYFPTFPQCLDIHGFLLKTGVH*FLQVYFHCRLQIIHQTMGIRDYLLTMDIRGYHP 94 VD DY + +DI L K + +L+ ++ + + IRDYL +DIR Y Sbjct: 81 VDIRDYL----EKVDIRDHLEKVDIRDYLE---KVDIRDYLEKVDIRDYLEKVDIRDYLE 133 Query: 93 TMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + IRDY + IRDY + + IRDY + + Sbjct: 134 EVDIRDYLEKVDIRDYLEKVDIRDYLEEV 162 Score = 43.6 bits (98), Expect = 1e-04 Identities = 25/76 (32%), Positives = 42/76 (55%) Frame = -3 Query: 234 LDIHGFLLKTGVH*FLQVYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGI 55 +DI +L K + +L+ ++ + + IRDYL +DIR Y + IRDY + I Sbjct: 99 VDIRDYLEKVDIRDYLE---KVDIRDYLEKVDIRDYLEEVDIRDYLEKVDIRDYLEKVDI 155 Query: 54 RDYHQTMGIRDYHQTI 7 RDY + + IRD+ + + Sbjct: 156 RDYLEEVDIRDHLEKV 171 Score = 42.3 bits (95), Expect = 3e-04 Identities = 20/48 (41%), Positives = 30/48 (62%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + + IRDYL +DIR Y + IRD+ + IRDY + + IRDY + + Sbjct: 70 EKVDIRDYLEKVDIRDYLEKVDIRDHLEKVDIRDYLEKVDIRDYLEKV 117 Score = 41.5 bits (93), Expect = 5e-04 Identities = 28/84 (33%), Positives = 44/84 (52%) Frame = -3 Query: 273 VDSHDYFPTFPQCLDIHGFLLKTGVH*FLQVYFHCRLQIIHQTMGIRDYLLTMDIRGYHP 94 VD DY + +DI +L K + +L+ ++ + + IRDYL +DIR Y Sbjct: 99 VDIRDYL----EKVDIRDYLEKVDIRDYLE---KVDIRDYLEEVDIRDYLEKVDIRDYLE 151 Query: 93 TMGIRDYHPTMGIRDYHQTMGIRD 22 + IRDY + IRD+ + + IRD Sbjct: 152 KVDIRDYLEEVDIRDHLEKVDIRD 175 Score = 40.7 bits (91), Expect = 9e-04 Identities = 19/48 (39%), Positives = 30/48 (62%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + + IRD+L +DIR Y + IRDY + IRD+ + + IRDY + + Sbjct: 7 EKVDIRDHLKEVDIRDYLEKVDIRDYLEKVDIRDHLEKVDIRDYLEKV 54 Score = 40.7 bits (91), Expect = 9e-04 Identities = 24/76 (31%), Positives = 42/76 (55%) Frame = -3 Query: 234 LDIHGFLLKTGVH*FLQVYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGI 55 +DI +L K + +L+ ++ + + IRDYL +DIR + + IRD+ + I Sbjct: 18 VDIRDYLEKVDIRDYLE---KVDIRDHLEKVDIRDYLEKVDIRDHLEKVDIRDHLEKVDI 74 Query: 54 RDYHQTMGIRDYHQTI 7 RDY + + IRDY + + Sbjct: 75 RDYLEKVDIRDYLEKV 90 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/48 (39%), Positives = 30/48 (62%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + + IRD+L +DIR Y + IRDY + IRD+ + + IRDY + + Sbjct: 61 EKVDIRDHLEKVDIRDYLEKVDIRDYLEKVDIRDHLEKVDIRDYLEKV 108 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/44 (43%), Positives = 28/44 (63%) Frame = -3 Query: 138 IRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 IRDYL +DIR + + IRDY + IRDY + + IRD+ + + Sbjct: 2 IRDYLEKVDIRDHLKEVDIRDYLEKVDIRDYLEKVDIRDHLEKV 45 Score = 39.5 bits (88), Expect = 0.002 Identities = 27/89 (30%), Positives = 45/89 (50%) Frame = -3 Query: 273 VDSHDYFPTFPQCLDIHGFLLKTGVH*FLQVYFHCRLQIIHQTMGIRDYLLTMDIRGYHP 94 VD DY + +DI +L K + +L+ ++ + + IRDYL +DIR Y Sbjct: 108 VDIRDYL----EKVDIRDYLEKVDIRDYLE---EVDIRDYLEKVDIRDYLEKVDIRDYLE 160 Query: 93 TMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + IRD+ + IRD + + RDY + + Sbjct: 161 EVDIRDHLEKVDIRDNLEKVDTRDYLEEV 189 Score = 39.1 bits (87), Expect = 0.003 Identities = 27/89 (30%), Positives = 46/89 (51%) Frame = -3 Query: 273 VDSHDYFPTFPQCLDIHGFLLKTGVH*FLQVYFHCRLQIIHQTMGIRDYLLTMDIRGYHP 94 VD DY + +DI +L K + L+ ++ + + IRD+L +DIR + Sbjct: 18 VDIRDYL----EKVDIRDYLEKVDIRDHLE---KVDIRDYLEKVDIRDHLEKVDIRDHLE 70 Query: 93 TMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + IRDY + IRDY + + IRD+ + + Sbjct: 71 KVDIRDYLEKVDIRDYLEKVDIRDHLEKV 99 Score = 37.1 bits (82), Expect = 0.011 Identities = 26/85 (30%), Positives = 43/85 (50%) Frame = -3 Query: 273 VDSHDYFPTFPQCLDIHGFLLKTGVH*FLQVYFHCRLQIIHQTMGIRDYLLTMDIRGYHP 94 VD DY + +DI +L + + +L+ ++ + + IRDYL +DIR + Sbjct: 117 VDIRDYL----EKVDIRDYLEEVDIRDYLE---KVDIRDYLEKVDIRDYLEEVDIRDHLE 169 Query: 93 TMGIRDYHPTMGIRDYHQTMGIRDY 19 + IRD + RDY + + IRDY Sbjct: 170 KVDIRDNLEKVDTRDYLEEVDIRDY 194 >SB_38212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1892 Score = 44.4 bits (100), Expect = 7e-05 Identities = 21/48 (43%), Positives = 30/48 (62%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + + IRDYL +DIR Y + IRDY + IRDY + + IRDY + + Sbjct: 636 EKVDIRDYLEKVDIRDYLEKVDIRDYLEKVDIRDYLEKVDIRDYLEKV 683 Score = 44.4 bits (100), Expect = 7e-05 Identities = 21/48 (43%), Positives = 30/48 (62%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + + IRDYL +DIR Y + IRDY + IRDY + + IRDY + + Sbjct: 645 EKVDIRDYLEKVDIRDYLEKVDIRDYLEKVDIRDYLEKVDIRDYLEEV 692 Score = 43.6 bits (98), Expect = 1e-04 Identities = 25/76 (32%), Positives = 42/76 (55%) Frame = -3 Query: 234 LDIHGFLLKTGVH*FLQVYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGI 55 +DI +L K + +L+ ++ + + IRDYL +DIR Y + IRDY + I Sbjct: 638 VDIRDYLEKVDIRDYLE---KVDIRDYLEKVDIRDYLEKVDIRDYLEKVDIRDYLEEVDI 694 Query: 54 RDYHQTMGIRDYHQTI 7 RD+ + + IRDY + + Sbjct: 695 RDHLEKVDIRDYVEKV 710 Score = 42.3 bits (95), Expect = 3e-04 Identities = 23/56 (41%), Positives = 33/56 (58%) Frame = -3 Query: 186 QVYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDY 19 +++FH +Q IRDYL +DIR Y + IRDY + IRDY + + IRD+ Sbjct: 422 RIHFHRPIQA-----NIRDYLEKVDIRDYLEKVDIRDYLEKVDIRDYLEKVDIRDH 472 Score = 41.1 bits (92), Expect = 7e-04 Identities = 30/95 (31%), Positives = 49/95 (51%), Gaps = 6/95 (6%) Frame = -3 Query: 273 VDSHDYFPTFPQCLDIHGFLLKTGVH*FLQ-VYFHCRLQIIH-----QTMGIRDYLLTMD 112 VD DY + +DI L+K + +L+ V F L + + + IRD+L +D Sbjct: 458 VDIRDYL----EKVDIRDHLVKVDIKDYLEKVDFRDYLDKVDIRDHLEKVDIRDHLEKVD 513 Query: 111 IRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 IR Y + IR++ + IRDY + + IRDY + + Sbjct: 514 IRDYQEKVDIREHLEKVDIRDYLEKVDIRDYLEKV 548 Score = 41.1 bits (92), Expect = 7e-04 Identities = 25/76 (32%), Positives = 41/76 (53%) Frame = -3 Query: 234 LDIHGFLLKTGVH*FLQVYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGI 55 +DI +L K + +L+ ++ + + IRD L +DIR Y + IRDY + I Sbjct: 602 VDIRDYLEKVDIRDYLE---KVDIRDHLEKVDIRDNLEKVDIRDYLEKVDIRDYLEKVDI 658 Query: 54 RDYHQTMGIRDYHQTI 7 RDY + + IRDY + + Sbjct: 659 RDYLEKVDIRDYLEKV 674 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/48 (39%), Positives = 29/48 (60%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + + IRDYL +DIR Y + IRDY + IRD+ + I+DY + + Sbjct: 438 EKVDIRDYLEKVDIRDYLEKVDIRDYLEKVDIRDHLVKVDIKDYLEKV 485 Score = 39.1 bits (87), Expect = 0.003 Identities = 27/85 (31%), Positives = 44/85 (51%) Frame = -3 Query: 273 VDSHDYFPTFPQCLDIHGFLLKTGVH*FLQVYFHCRLQIIHQTMGIRDYLLTMDIRGYHP 94 VD DY + +DI +L K + +L+ ++ + + IRDYL +DIR Y Sbjct: 638 VDIRDYL----EKVDIRDYLEKVDIRDYLE---KVDIRDYLEKVDIRDYLEKVDIRDYLE 690 Query: 93 TMGIRDYHPTMGIRDYHQTMGIRDY 19 + IRD+ + IRDY + + I D+ Sbjct: 691 EVDIRDHLEKVDIRDYVEKVDIWDH 715 Score = 38.7 bits (86), Expect = 0.003 Identities = 18/44 (40%), Positives = 27/44 (61%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDY 19 + + IRDYL +DIR Y + IRD+ + I+DY + + RDY Sbjct: 447 EKVDIRDYLEKVDIRDYLEKVDIRDHLVKVDIKDYLEKVDFRDY 490 Score = 38.7 bits (86), Expect = 0.003 Identities = 19/48 (39%), Positives = 29/48 (60%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + + IRDYL +DIR + + IRD + IRDY + + IRDY + + Sbjct: 573 EKVDIRDYLEKVDIRDHLEKVDIRDNLEKVDIRDYLEKVDIRDYLEKV 620 Score = 38.7 bits (86), Expect = 0.003 Identities = 19/48 (39%), Positives = 29/48 (60%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + + IRDYL +DIR Y + IRD+ + IRD + + IRDY + + Sbjct: 600 EKVDIRDYLEKVDIRDYLEKVDIRDHLEKVDIRDNLEKVDIRDYLEKV 647 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/48 (37%), Positives = 30/48 (62%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + + IRDYL +DIR + + IRDY + IR++ + + IRDY + + Sbjct: 537 EKVDIRDYLEKVDIREHLEKVDIRDYLEKVDIREHLEKVDIRDYLEKV 584 Score = 37.1 bits (82), Expect = 0.011 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + + IR++L +DIR Y + IRDY + IR++ + + IRDY + + Sbjct: 519 EKVDIREHLEKVDIRDYLEKVDIRDYLEKVDIREHLEKVDIRDYLEKV 566 Score = 37.1 bits (82), Expect = 0.011 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + + IRDYL +DIR Y + IR++ + IRDY + + IR++ + + Sbjct: 528 EKVDIRDYLEKVDIRDYLEKVDIREHLEKVDIRDYLEKVDIREHLEKV 575 Score = 37.1 bits (82), Expect = 0.011 Identities = 24/71 (33%), Positives = 39/71 (54%) Frame = -3 Query: 234 LDIHGFLLKTGVH*FLQVYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGI 55 +DI +L K + +L+ R + + + IRDYL +DIR + + IRDY + I Sbjct: 530 VDIRDYLEKVDIRDYLEKV-DIREHL--EKVDIRDYLEKVDIREHLEKVDIRDYLEKVDI 586 Query: 54 RDYHQTMGIRD 22 RD+ + + IRD Sbjct: 587 RDHLEKVDIRD 597 Score = 36.7 bits (81), Expect = 0.014 Identities = 18/48 (37%), Positives = 29/48 (60%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + + IRD+L +DIR + IRDY + IRDY + + IRD+ + + Sbjct: 582 EKVDIRDHLEKVDIRDNLEKVDIRDYLEKVDIRDYLEKVDIRDHLEKV 629 Score = 36.3 bits (80), Expect = 0.019 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + + IRDYL +DIR + + I+DY + RDY + IRD+ + + Sbjct: 456 EKVDIRDYLEKVDIRDHLVKVDIKDYLEKVDFRDYLDKVDIRDHLEKV 503 Score = 35.9 bits (79), Expect = 0.025 Identities = 17/48 (35%), Positives = 29/48 (60%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + + IRDY +DIR + + IRDY + IRDY + + IR++ + + Sbjct: 510 EKVDIRDYQEKVDIREHLEKVDIRDYLEKVDIRDYLEKVDIREHLEKV 557 Score = 35.9 bits (79), Expect = 0.025 Identities = 26/89 (29%), Positives = 45/89 (50%) Frame = -3 Query: 273 VDSHDYFPTFPQCLDIHGFLLKTGVH*FLQVYFHCRLQIIHQTMGIRDYLLTMDIRGYHP 94 VD DY + +DI +L K + L+ ++ + + IR++L +DIR Y Sbjct: 530 VDIRDYL----EKVDIRDYLEKVDIREHLE---KVDIRDYLEKVDIREHLEKVDIRDYLE 582 Query: 93 TMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 + IRD+ + IRD + + IRDY + + Sbjct: 583 KVDIRDHLEKVDIRDNLEKVDIRDYLEKV 611 Score = 35.5 bits (78), Expect = 0.032 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRD 22 + + IRD L +DIR Y + IRDY + IRD+ + + IRD Sbjct: 591 EKVDIRDNLEKVDIRDYLEKVDIRDYLEKVDIRDHLEKVDIRD 633 Score = 35.1 bits (77), Expect = 0.043 Identities = 25/84 (29%), Positives = 42/84 (50%) Frame = -3 Query: 273 VDSHDYFPTFPQCLDIHGFLLKTGVH*FLQVYFHCRLQIIHQTMGIRDYLLTMDIRGYHP 94 VD DY + +DI +L K + +L+ ++ + + IRDYL +DIR + Sbjct: 647 VDIRDYL----EKVDIRDYLEKVDIRDYLE---KVDIRDYLEKVDIRDYLEEVDIRDHLE 699 Query: 93 TMGIRDYHPTMGIRDYHQTMGIRD 22 + IRDY + I D+ + +RD Sbjct: 700 KVDIRDYVEKVDIWDHLEEADVRD 723 Score = 32.7 bits (71), Expect = 0.23 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -3 Query: 114 DIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 +IR Y + IRDY + IRDY + + IRDY + + Sbjct: 432 NIRDYLEKVDIRDYLEKVDIRDYLEKVDIRDYLEKV 467 >SB_55969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/81 (20%), Positives = 42/81 (51%), Gaps = 3/81 (3%) Frame = -3 Query: 240 QCLDIHGFLLKTGVH*FLQ---VYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYH 70 +C D+H L VH L+ V++ + +H ++ +D +++ + H ++ +D H Sbjct: 10 ECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVH 69 Query: 69 PTMGIRDYHQTMGIRDYHQTI 7 ++ +D H ++ +D H ++ Sbjct: 70 YSLECKDVHYSLECKDVHYSL 90 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/81 (20%), Positives = 42/81 (51%), Gaps = 3/81 (3%) Frame = -3 Query: 240 QCLDIHGFLLKTGVH*FLQ---VYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYH 70 +C D+H L VH L+ V++ + +H ++ +D +++ + H ++ +D H Sbjct: 19 ECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVH 78 Query: 69 PTMGIRDYHQTMGIRDYHQTI 7 ++ +D H ++ +D H ++ Sbjct: 79 YSLECKDVHYSLECKDVHYSL 99 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/81 (20%), Positives = 42/81 (51%), Gaps = 3/81 (3%) Frame = -3 Query: 240 QCLDIHGFLLKTGVH*FLQ---VYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYH 70 +C D+H L VH L+ V++ + +H ++ +D +++ + H ++ +D H Sbjct: 28 ECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVH 87 Query: 69 PTMGIRDYHQTMGIRDYHQTI 7 ++ +D H ++ +D H ++ Sbjct: 88 YSLECKDVHYSLECKDVHYSL 108 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/81 (20%), Positives = 42/81 (51%), Gaps = 3/81 (3%) Frame = -3 Query: 240 QCLDIHGFLLKTGVH*FLQ---VYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYH 70 +C D+H L VH L+ V++ + +H ++ +D +++ + H ++ +D H Sbjct: 37 ECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVH 96 Query: 69 PTMGIRDYHQTMGIRDYHQTI 7 ++ +D H ++ +D H ++ Sbjct: 97 YSLECKDVHYSLECKDVHYSL 117 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/81 (20%), Positives = 42/81 (51%), Gaps = 3/81 (3%) Frame = -3 Query: 240 QCLDIHGFLLKTGVH*FLQ---VYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYH 70 +C D+H L VH L+ V++ + +H ++ +D +++ + H ++ +D H Sbjct: 46 ECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVH 105 Query: 69 PTMGIRDYHQTMGIRDYHQTI 7 ++ +D H ++ +D H ++ Sbjct: 106 YSLECKDVHYSLECKDVHYSL 126 Score = 37.5 bits (83), Expect = 0.008 Identities = 18/78 (23%), Positives = 40/78 (51%), Gaps = 3/78 (3%) Frame = -3 Query: 240 QCLDIHGFLLKTGVH*FLQ---VYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYH 70 +C D+H L VH L+ V++ + +H ++ +D +++ + H ++ +D H Sbjct: 73 ECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDAH 132 Query: 69 PTMGIRDYHQTMGIRDYH 16 ++ +D H ++ RD H Sbjct: 133 YSLECKDVHYSLECRDVH 150 Score = 37.1 bits (82), Expect = 0.011 Identities = 17/81 (20%), Positives = 42/81 (51%), Gaps = 3/81 (3%) Frame = -3 Query: 240 QCLDIHGFLLKTGVH*FLQ---VYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYH 70 +C D+H L VH L+ V++ + +H ++ +D +++ + H ++ +D H Sbjct: 55 ECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVH 114 Query: 69 PTMGIRDYHQTMGIRDYHQTI 7 ++ +D H ++ +D H ++ Sbjct: 115 YSLECKDVHYSLECKDAHYSL 135 Score = 37.1 bits (82), Expect = 0.011 Identities = 17/81 (20%), Positives = 42/81 (51%), Gaps = 3/81 (3%) Frame = -3 Query: 240 QCLDIHGFLLKTGVH*FLQ---VYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYH 70 +C D+H L VH L+ V++ + +H ++ +D +++ + H ++ +D H Sbjct: 64 ECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVH 123 Query: 69 PTMGIRDYHQTMGIRDYHQTI 7 ++ +D H ++ +D H ++ Sbjct: 124 YSLECKDAHYSLECKDVHYSL 144 Score = 36.7 bits (81), Expect = 0.014 Identities = 17/80 (21%), Positives = 41/80 (51%), Gaps = 3/80 (3%) Frame = -3 Query: 237 CLDIHGFLLKTGVH*FLQ---VYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHP 67 C D+H L VH L+ V++ + +H ++ +D +++ + H ++ +D H Sbjct: 2 CKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHY 61 Query: 66 TMGIRDYHQTMGIRDYHQTI 7 ++ +D H ++ +D H ++ Sbjct: 62 SLECKDVHYSLECKDVHYSL 81 >SB_53461| Best HMM Match : Amelogenin (HMM E-Value=0.099) Length = 2489 Score = 37.1 bits (82), Expect = 0.011 Identities = 12/47 (25%), Positives = 27/47 (57%) Frame = -3 Query: 156 IHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYH 16 +H + +R+ + +R HP+ +R+ HP+ +R+ H + +R+ H Sbjct: 1774 MHPSRPVREMHPSRPVREMHPSKPVREMHPSSPVREMHSSRAVREMH 1820 Score = 37.1 bits (82), Expect = 0.011 Identities = 12/47 (25%), Positives = 27/47 (57%) Frame = -3 Query: 156 IHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYH 16 +H + +R+ + +R HP+ +R+ HP+ +R+ H + +R+ H Sbjct: 1810 MHSSRAVREMHPSRPVREMHPSSPVREMHPSRPVREMHPSKPVREMH 1856 Score = 35.9 bits (79), Expect = 0.025 Identities = 12/47 (25%), Positives = 27/47 (57%) Frame = -3 Query: 156 IHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYH 16 +H + +R+ + +R HP+ +R+ HP+ +R+ H + +R+ H Sbjct: 1801 MHPSSPVREMHSSRAVREMHPSRPVREMHPSSPVREMHPSRPVREMH 1847 Score = 35.9 bits (79), Expect = 0.025 Identities = 12/47 (25%), Positives = 27/47 (57%) Frame = -3 Query: 156 IHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYH 16 +H + +R+ + +R HP+ +R+ HP+ +R+ H + +R+ H Sbjct: 1819 MHPSRPVREMHPSSPVREMHPSRPVREMHPSKPVREMHPSRPVREMH 1865 Score = 35.9 bits (79), Expect = 0.025 Identities = 12/47 (25%), Positives = 27/47 (57%) Frame = -3 Query: 156 IHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYH 16 +H + +R+ + +R HP+ +R+ HP+ +R+ H + +R+ H Sbjct: 1828 MHPSSPVREMHPSRPVREMHPSKPVREMHPSRPVREMHPSRPVREMH 1874 Score = 34.7 bits (76), Expect = 0.057 Identities = 12/49 (24%), Positives = 28/49 (57%) Frame = -3 Query: 156 IHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQT 10 +H + +R+ + +R HP+ +R+ HP+ +R+ H + +R+ + T Sbjct: 1837 MHPSRPVREMHPSKPVREMHPSRPVREMHPSRPVREMHPSRPVREMNPT 1885 Score = 33.9 bits (74), Expect = 0.099 Identities = 11/43 (25%), Positives = 25/43 (58%) Frame = -3 Query: 138 IRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQT 10 +R+ + +R HP+ +R+ HP+ +R+ H + +R+ H + Sbjct: 1771 VREMHPSRPVREMHPSRPVREMHPSKPVREMHPSSPVREMHSS 1813 >SB_45362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 37.1 bits (82), Expect = 0.011 Identities = 17/80 (21%), Positives = 41/80 (51%), Gaps = 3/80 (3%) Frame = -3 Query: 237 CLDIHGFLLKTGVH*FLQ---VYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHP 67 C D+H L VH L+ V++ + +H ++ +D +++ + H ++ +D H Sbjct: 2 CKDVHYSLEYKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHY 61 Query: 66 TMGIRDYHQTMGIRDYHQTI 7 ++ +D H ++ +D H ++ Sbjct: 62 SLECKDVHYSLECKDVHYSL 81 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/78 (20%), Positives = 40/78 (51%), Gaps = 3/78 (3%) Frame = -3 Query: 231 DIHGFLLKTGVH*FLQ---VYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTM 61 D+H L VH L+ V++ + +H ++ +D +++ + H ++ +D H ++ Sbjct: 13 DVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSLECKDVHYSL 72 Query: 60 GIRDYHQTMGIRDYHQTI 7 +D H ++ +D H ++ Sbjct: 73 ECKDVHYSLECKDAHYSL 90 >SB_17315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 405 Score = 35.9 bits (79), Expect = 0.025 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -3 Query: 132 DYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTIH 4 DY M R Y M RDY + RDY + + RDY + ++ Sbjct: 121 DYDRVMSYRDYDRVMSYRDYERVVSYRDYERVLYYRDYERVLY 163 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDY 19 + M RDY M R Y + RDY + RDY + + RDY Sbjct: 124 RVMSYRDYDRVMSYRDYERVVSYRDYERVLYYRDYERVLYYRDY 167 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 35.5 bits (78), Expect = 0.032 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = +3 Query: 189 GTNGHPSSGGNHGYPGTGGMSGNNHGYQPKKPAVYQYNPPQQIRYTPVGGGSPVNYPVYR 368 G G P GG GY G G G GY Y Y Y GG +Y Y Sbjct: 436 GGRGGPRGGGPRGYDGGYGQGGGYEGYSGGYRDDYGYGGGSYDHYDSYYGGGYDDY--YG 493 Query: 369 GSPP 380 G PP Sbjct: 494 GGPP 497 >SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) Length = 346 Score = 35.5 bits (78), Expect = 0.032 Identities = 27/68 (39%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +3 Query: 189 GTNGHPSSGGNHGYPGTGGMSGNNHGYQPKKPAVYQYNPPQQIRYTPVGGGSPVNYPVYR 368 GT G P G G PG+ G+SG GY P P +PP P G P P YR Sbjct: 45 GTEGPPGPQGTKGPPGSQGLSG-VQGY-PGAPGPRGRSPP-----GPPGIPGPRGLPGYR 97 Query: 369 G--SPPTY 386 G PP Y Sbjct: 98 GPKGPPGY 105 >SB_23827| Best HMM Match : DUF809 (HMM E-Value=9.1) Length = 159 Score = 35.1 bits (77), Expect = 0.043 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = -3 Query: 153 HQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQT 10 H T + Y +T + YH T + YH T + YH T + YH T Sbjct: 39 HVTYYVTPYHVTYCVTPYHVTYCVTPYHVTYYVTPYHVTYSVTLYHVT 86 Score = 32.3 bits (70), Expect = 0.30 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = -3 Query: 153 HQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQT 10 H T + Y +T + YH + YH T + YH T + YH T Sbjct: 12 HMTYYVTSYHVTYCMTPYHVPDCVTPYHVTYYVTPYHVTYCVTPYHVT 59 Score = 32.3 bits (70), Expect = 0.30 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -3 Query: 138 IRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQT 10 + Y +T + YH T + YH T + YH T + YH T Sbjct: 35 VTPYHVTYYVTPYHVTYCVTPYHVTYCVTPYHVTYYVTPYHVT 77 Score = 31.5 bits (68), Expect = 0.53 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -3 Query: 153 HQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTIH 4 H T + Y + + YH T + YH T + YH T + YH T + Sbjct: 21 HVTYCMTPYHVPDCVTPYHVTYYVTPYHVTYCVTPYHVTYCVTPYHVTYY 70 Score = 30.7 bits (66), Expect = 0.92 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = -3 Query: 153 HQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDY 19 H T + Y +T + YH T + YH T + YH T + Y Sbjct: 48 HVTYCVTPYHVTYCVTPYHVTYYVTPYHVTYSVTLYHVTYCVTPY 92 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = -3 Query: 138 IRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQT 10 + Y +T + YH T + YH + YH T + YH T Sbjct: 8 VTSYHMTYYVTSYHVTYCMTPYHVPDCVTPYHVTYYVTPYHVT 50 >SB_2570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 33.5 bits (73), Expect = 0.13 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = +3 Query: 189 GTNGHPSSGGNHGYPGTGGMSGNNHGYQPKKPAVYQYNPP 308 G NG P G HG PGT G SGN+ G K A PP Sbjct: 35 GKNGIPGIPGVHGKPGTPGKSGND-GRNGKPGAPGPKGPP 73 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 32.3 bits (70), Expect = 0.30 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = +3 Query: 183 PGGTNGHPSSGGNHGYPGTGGMSGNNHGYQPKKPAVYQYNPPQQIRY 323 P G G P + +G P T G G P +P+ YN P Y Sbjct: 83 PSGQYGAPPTSQPYGAPPTSGYPGYQQHPPPPQPSAQSYNAPPPAGY 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 23/68 (33%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = +3 Query: 183 PGGTNGHPSSGGNHGYPGTGGMS-GNNHGYQPKKPAVYQYNPPQQIRYTPVGGGSPVNYP 359 P G+P + G GYP +GG GY P +P Y PP +GG P Sbjct: 31 PPAPGGYPPAPG--GYPPSGGYGYPPAGGYPPPQPG-YAGGPPPPGIAPGIGGPPPSG-- 85 Query: 360 VYRGSPPT 383 G+PPT Sbjct: 86 -QYGAPPT 92 Score = 27.9 bits (59), Expect = 6.5 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +3 Query: 225 GYP--GTGGMSGNNHGYQPKKPAVYQYNPPQQIRYTPVGGGSPVNYPVYRGSPP 380 GYP GG GY P P Y PP P GG P P Y G PP Sbjct: 21 GYPPAAPGGYPPAPGGYPPA-PGGY---PPSGGYGYPPAGGYPPPQPGYAGGPP 70 >SB_38138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 568 Score = 32.3 bits (70), Expect = 0.30 Identities = 17/59 (28%), Positives = 35/59 (59%) Frame = -3 Query: 183 VYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 VY +Q ++QT+ I+ T+ I+ + T+ I+ + T+ I+ +QT+ I+ +QT+ Sbjct: 88 VYQTVSIQYVYQTVSIQYAYRTVSIQYAYRTVSIQYAYRTVSIQYVYQTVSIQYAYQTV 146 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/53 (26%), Positives = 33/53 (62%) Frame = -3 Query: 165 LQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 +Q ++QT+ I+ T+ I+ + T+ I+ + T+ I+ +QT+ I+ ++T+ Sbjct: 58 IQYVYQTVSIQYAYQTVSIQYAYRTVSIQYVYQTVSIQYVYQTVSIQYAYRTV 110 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/59 (27%), Positives = 34/59 (57%) Frame = -3 Query: 183 VYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 VY +Q ++T+ I+ T+ I+ + T+ I+ + T+ I+ +QT+ I+ +QT+ Sbjct: 97 VYQTVSIQYAYRTVSIQYAYRTVSIQYAYRTVSIQYVYQTVSIQYAYQTVSIQFAYQTV 155 Score = 29.5 bits (63), Expect = 2.1 Identities = 15/58 (25%), Positives = 34/58 (58%) Frame = -3 Query: 180 YFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 Y+ +Q +QT+ I+ T+ I+ + T+ I+ + T+ I+ +QT+ I+ ++T+ Sbjct: 413 YWTVSIQYAYQTVSIQYAYQTVSIQYAYRTVSIQYAYQTVSIQFAYQTVSIQYVYRTV 470 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/53 (28%), Positives = 32/53 (60%) Frame = -3 Query: 165 LQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 +Q +QT+ I+ T+ I+ + T+ I+ + T+ I+ +QT+ I+ +QT+ Sbjct: 445 IQYAYQTVSIQFAYQTVSIQYVYRTVSIQYAYRTVSIQFAYQTVSIQYAYQTV 497 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/53 (26%), Positives = 32/53 (60%) Frame = -3 Query: 165 LQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 +Q ++T+ I+ T+ I+ + T+ I+ + T+ I+ +QT+ I+ +QT+ Sbjct: 49 IQYAYRTVSIQYVYQTVSIQYAYQTVSIQYAYRTVSIQYVYQTVSIQYVYQTV 101 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/53 (28%), Positives = 32/53 (60%) Frame = -3 Query: 165 LQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 +Q +QT+ I+ T+ I+ + T+ I+ + T+ I+ +QT+ I+ +QT+ Sbjct: 301 IQYAYQTVSIQYVYRTVSIQYAYRTVSIQYAYWTVSIQFAYQTVSIQYAYQTV 353 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/58 (25%), Positives = 32/58 (55%) Frame = -3 Query: 180 YFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 Y+ +Q +QT+ I+ T+ I+ + + I+ + T+ I+ +QT+ I+ QT+ Sbjct: 332 YWTVSIQFAYQTVSIQYAYQTVSIQYAYQAVSIQYAYQTVSIQYAYQTVSIQYAFQTV 389 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/53 (26%), Positives = 33/53 (62%) Frame = -3 Query: 165 LQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 +Q ++QT+ I+ T+ I+ + T+ I+ + T+ I+ +QT+ I+ ++T+ Sbjct: 391 IQYVYQTVSIQYAYQTVSIQYAYWTVSIQYAYQTVSIQYAYQTVSIQYAYRTV 443 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/53 (28%), Positives = 31/53 (58%) Frame = -3 Query: 165 LQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 +Q QT+ I+ T+ I+ + T+ I+ + T+ I+ +QT+ I+ +QT+ Sbjct: 382 IQYAFQTVSIQYVYQTVSIQYAYQTVSIQYAYWTVSIQYAYQTVSIQYAYQTV 434 >SB_25003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 31.5 bits (68), Expect = 0.53 Identities = 25/74 (33%), Positives = 33/74 (44%), Gaps = 2/74 (2%) Frame = +3 Query: 195 NGHPSSGGNHGYPGTGGMSGNNHGYQPKKPA-VYQYN-PPQQIRYTPVGGGSPVNYPVYR 368 +GHP+ GYP SG+ +GYQ YQY+ P +Y+ G P Y Y Sbjct: 74 SGHPNGYQYSGYPNGYQYSGHPNGYQYSGHLNGYQYSGHPNGYQYS----GHPNGYQ-YS 128 Query: 369 GSPPTYVYQVKDSG 410 G P Y Y +G Sbjct: 129 GHPNGYQYSGHPNG 142 Score = 31.1 bits (67), Expect = 0.70 Identities = 28/82 (34%), Positives = 38/82 (46%), Gaps = 7/82 (8%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGGM-----SGNNHGYQ-PKKPAVYQYN-PPQQIRYTPVGGGS 344 G NG+ SG +GY +G + SG+ +GYQ P YQY+ P +Y+ G Sbjct: 84 GYPNGYQYSGHPNGYQYSGHLNGYQYSGHPNGYQYSGHPNGYQYSGHPNGYQYS----GH 139 Query: 345 PVNYPVYRGSPPTYVYQVKDSG 410 P Y Y G P Y Y +G Sbjct: 140 PNGYQ-YSGHPNGYQYSGHPNG 160 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 31.5 bits (68), Expect = 0.53 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +3 Query: 198 GHPSSGGNHGYPGTGGMSGNNHGY 269 G+PS+G N GYPG GNN GY Sbjct: 249 GYPSNG-NMGYPGNRNGMGNNMGY 271 Score = 31.1 bits (67), Expect = 0.70 Identities = 19/59 (32%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = +3 Query: 189 GTNGHPSSGGNHGYPGTGGMS--GNNHGYQPKKPAVYQYNPPQQIRYTPVGGGSPVNYP 359 G G+PS+ N GYP G M GN +G N + Y P G + YP Sbjct: 237 GNMGYPSNNNNMGYPSNGNMGYPGNRNGMGNNMGYPSNGNGNGNMGY-PSNGNGNMGYP 294 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 31.1 bits (67), Expect = 0.70 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGG-MSGNNHG 266 GG NG ++GGN G GG GNN+G Sbjct: 544 GGNNGGSNNGGNDGSNNNGGNTGGNNNG 571 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGGMSGNNHG 266 GG +G ++GGN G GG +G N+G Sbjct: 553 GGNDGSNNNGGNTGGNNNGGNTGGNNG 579 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +3 Query: 180 KPGGTNGHPSSGGNHGYPGTGG-MSGNNHG 266 K G TNG ++GGN+G GG G+N+G Sbjct: 422 KGGNTNGGNNNGGNNGGNNNGGNTGGDNNG 451 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGGMSGNNHG 266 GG G ++GGN G GG +G N+G Sbjct: 579 GGNTGGNNNGGNTGGNNNGGNTGGNNG 605 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGGMSGNNHG 266 GG G ++GGN G GG +G N+G Sbjct: 605 GGNTGGNNNGGNTGGNNNGGNTGGNNG 631 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGGMSGNNHG 266 GG N ++GGN+ TGG +G N G Sbjct: 583 GGNNNGGNTGGNNNGGNTGGNNGGNTG 609 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGGMSGNNHG 266 GG N ++GGN+ TGG +G N G Sbjct: 609 GGNNNGGNTGGNNNGGNTGGNNGGNTG 635 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGGMSGNNHG 266 GG G ++GGN G G GNN+G Sbjct: 562 GGNTGGNNNGGNTGGNNGGNTGGNNNG 588 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGGMSGNNHG 266 GG G ++GGN G G GNN+G Sbjct: 588 GGNTGGNNNGGNTGGNNGGNTGGNNNG 614 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGGMSGNNHG 266 GG G ++GGN G G GNN+G Sbjct: 614 GGNTGGNNNGGNTGGNNGGNTGGNNNG 640 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGGMSGNNH 263 G NG ++GGN+G GG G+N+ Sbjct: 535 GENNGGNNNGGNNGGSNNGGNDGSNN 560 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGG--MSGNNHG 266 GG N ++GGN+ TGG GNN+G Sbjct: 428 GGNNNGGNNGGNNNGGNTGGDNNGGNNYG 456 >SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1041 Score = 31.1 bits (67), Expect = 0.70 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +3 Query: 273 PKKPAVYQYNPPQQIRYTPVGGGSPVNYPVYRGSP 377 P P QY+P QQI+Y +P NY V+RG P Sbjct: 538 PPAPGQPQYHPAQQIQYQ-----NPGNYRVHRGPP 567 >SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) Length = 892 Score = 31.1 bits (67), Expect = 0.70 Identities = 22/71 (30%), Positives = 26/71 (36%) Frame = +3 Query: 201 HPSSGGNHGYPGTGGMSGNNHGYQPKKPAVYQYNPPQQIRYTPVGGGSPVNYPVYRGSPP 380 H G H Y G + N GY P++P PP Y P P P Y G PP Sbjct: 812 HAPPGQAH-YQQLGAAAPNQGGYHPQQP------PPPPQGYEPQPQYQPQGPPQYYGGPP 864 Query: 381 TYVYQVKDSGS 413 Q + S Sbjct: 865 PQQQQQRQPQS 875 >SB_26644| Best HMM Match : Collagen (HMM E-Value=0) Length = 877 Score = 30.3 bits (65), Expect = 1.2 Identities = 22/65 (33%), Positives = 25/65 (38%) Frame = +3 Query: 183 PGGTNGHPSSGGNHGYPGTGGMSGNNHGYQPKKPAVYQYNPPQQIRYTPVGGGSPVNYPV 362 P G NG P G G G G+SG P+ A Q PP P G PV Sbjct: 797 PSGKNGEPGPQGPEGEAGANGVSGPKGEMGPEGEA-GQPGPP-----GPPGPNGPVGQTG 850 Query: 363 YRGSP 377 G+P Sbjct: 851 QPGTP 855 >SB_19164| Best HMM Match : Collagen (HMM E-Value=0.0024) Length = 60 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 189 GTNGHPSSGGNHGYPGTGGMSG 254 G +G P G HG+PG GM G Sbjct: 23 GRDGRPGPPGRHGFPGQRGMPG 44 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGGMSGNNHGYQPK 278 GG++G+ + G++GY G GG N++G K Sbjct: 406 GGSSGNGAEEGDNGYSGGGGAGLNSNGRNNK 436 >SB_29755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 585 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -3 Query: 147 TMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRD 22 T + D +T ++ G T + D H T + D H T + D Sbjct: 75 TKALEDRRITKELEGRRVTKALEDRHVTKALEDRHVTKALED 116 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGGMSGNNHGYQPKK 281 G G P GG GY G G N+ YQ K Sbjct: 197 GDYGGGPGYGGGQGYGSYSGGGGGNYDYQGNK 228 >SB_21936| Best HMM Match : Collagen (HMM E-Value=1.1e-07) Length = 195 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = +3 Query: 189 GTNGHPSSGGNHGYPGTGGMSGNNHGYQPKKPAVYQYNPP 308 G NG P G G PGT G SGN+ G K A PP Sbjct: 35 GKNGIPGIPGVPGKPGTPGKSGND-GRNGKPGAPGPKGPP 73 >SB_30949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/59 (20%), Positives = 28/59 (47%) Frame = -3 Query: 183 VYFHCRLQIIHQTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRDYHQTI 7 +Y L+ I+ +G+R +DIR + + IR + + +R + + +R + + Sbjct: 62 IYSALGLRPIYSALGLRPIYSALDIRPIYSALDIRPIYSALDLRPIYSALDLRPIYSAL 120 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 189 GTNGHPSSGGNHGYPGTGGMSGN 257 G NG+ SSG N+G GG GN Sbjct: 138 GENGYRSSGTNYGQSRAGGTGGN 160 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 29.1 bits (62), Expect = 2.8 Identities = 17/42 (40%), Positives = 20/42 (47%) Frame = +3 Query: 261 HGYQPKKPAVYQYNPPQQIRYTPVGGGSPVNYPVYRGSPPTY 386 H Y P+ P Y PP IRY P+ P + P Y S P Y Sbjct: 311 HRY-PQSPLRY---PPSPIRYPPLPSRYPPSPPRYPSSHPRY 348 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 282 PAVYQYNPPQQIRYTPVGGGSPVNYPVYRGSPPTY 386 P+ +Y PP RY P P ++P Y SPP Y Sbjct: 322 PSPIRY-PPLPSRYPPSPPRYPSSHPRYPPSPPRY 355 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +3 Query: 273 PKKPAVYQYNPPQQIRYTPVGGGSPVNYPVYRGSPPTYV 389 P+ P+ + PP RY P P ++P Y SP Y+ Sbjct: 339 PRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYL 377 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 183 PGGTNGHPSSGGNHGYPGTGGMSGNNHG 266 PGG G G G+PG GGM G G Sbjct: 179 PGGMPGGMPGGMPGGFPGAGGMPGGFPG 206 Score = 28.7 bits (61), Expect = 3.7 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 6/70 (8%) Frame = +3 Query: 186 GGTNGHPSSGGNHG-YPGTGGMSGNNHGYQ----PKKPAVYQ-YNPPQQIRYTPVGGGSP 347 G G P +GG G +PG GGM G G P V Q + P+ + +P Sbjct: 199 GMPGGFPGAGGMPGGFPGAGGMPGGPGGIDINTILNDPEVMQAFQDPEVMAAFQDVNQNP 258 Query: 348 VNYPVYRGSP 377 N Y+ +P Sbjct: 259 ANMAKYQNNP 268 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRD 22 ++ G+R+ + +R + G+RD + G RD ++ G+RD Sbjct: 43 ESQGLRNAGESRGLRNADESQGLRDAGKSQGFRDQGESRGLRD 85 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = -3 Query: 150 QTMGIRDYLLTMDIRGYHPTMGIRDYHPTMGIRDYHQTMGIRD 22 ++ G+RD + +R + G+R+ + G+RD ++ G RD Sbjct: 34 ESQGLRDEGESQGLRNAGESRGLRNADESQGLRDAGKSQGFRD 76 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = +3 Query: 270 QPKKPAVYQYNPPQQIRYTPVGGGSPVNYPVYRGSPPTY 386 QP P PP Y P+ P P Y + P+Y Sbjct: 197 QPSYPPTAPSYPPTPSSYPPIAASYPPTAPSYNPTAPSY 235 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/38 (31%), Positives = 15/38 (39%) Frame = +3 Query: 273 PKKPAVYQYNPPQQIRYTPVGGGSPVNYPVYRGSPPTY 386 P P + PP Q Y P P P Y + P+Y Sbjct: 170 PSYPPTQPFYPPTQPFYPPTPSSYPPTQPSYPPTAPSY 207 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 28.3 bits (60), Expect = 4.9 Identities = 23/75 (30%), Positives = 25/75 (33%) Frame = +3 Query: 186 GGTNGHPSSGGNHGYPGTGGMSGNNHGYQPKKPAVYQYNPPQQIRYTPVGGGSPVNYPVY 365 GG G GG G G GG G GY Y Y GGG +Y Y Sbjct: 200 GGYGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGG-GGGYGSSYGSY 258 Query: 366 RGSPPTYVYQVKDSG 410 G +Y SG Sbjct: 259 DGYGSMGMYNQSSSG 273 >SB_8542| Best HMM Match : PT (HMM E-Value=4) Length = 650 Score = 28.3 bits (60), Expect = 4.9 Identities = 18/64 (28%), Positives = 26/64 (40%) Frame = +3 Query: 201 HPSSGGNHGYPGTGGMSGNNHGYQPKKPAVYQYNPPQQIRYTPVGGGSPVNYPVYRGSPP 380 +PS Y +G + +P+ Y + PQ RY P G P YP G+P Sbjct: 277 YPSGNPQSRYYPSGNPQPRYYPSGNPQPSYYPFGNPQP-RYYPYGNPQPKYYP--SGNPQ 333 Query: 381 TYVY 392 + Y Sbjct: 334 SRYY 337 >SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16) Length = 3999 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 Query: 183 PGGTNGHPSSGGNHGYPGTGGMSGNNHGY 269 PGGT P +GG G GTGG G G+ Sbjct: 2938 PGGTG--PGAGGTLGSRGTGGGYGGKGGH 2964 >SB_17317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 189 GTNGHPSSGGNHGYPGTGGMSG 254 G NG P G G PGT G SG Sbjct: 151 GANGQPGLPGRDGVPGTVGESG 172 >SB_15078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 183 PGGTNGHPSSGGNHGYPGTGGMSG--NNHG 266 P GT G P G+ G PG G+ G NN G Sbjct: 244 PKGTPGDPGPTGSRGRPGKPGLPGDLNNIG 273 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 183 PGGTNGHPSSGGNHGYPGTGGMSGNNHG 266 P G NG P G G PG G +GN G Sbjct: 727 PPGPNGPPGPNGPLGPPGECGPAGNAGG 754 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 183 PGGTNGHPSSGGNHGYPGTGGMSGN--NHGYQPKKP 284 P G G P G G PG G +GN G QP P Sbjct: 897 PPGPKGPPGPNGCLGPPGDAGPAGNTGGAGCQPAPP 932 >SB_50003| Best HMM Match : PAN (HMM E-Value=0.044) Length = 286 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 466 LAQLTLAAIAVTNIPPNQVKRVCLAFKKTTATMRKLKS 579 L T AA AV + PP Q R +AF +TT + KS Sbjct: 78 LDNYTSAAAAVPSTPPKQDPRSTVAFGRTTKSSPVQKS 115 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 27.5 bits (58), Expect = 8.6 Identities = 19/71 (26%), Positives = 28/71 (39%), Gaps = 3/71 (4%) Frame = +3 Query: 183 PGGTNGHPSSGGNHGYPGTGGMSGNNHGYQPKKPAVYQYNP---PQQIRYTPVGGGSPVN 353 PG + PSSG + P + S + Y P P+ +P P Y+P Sbjct: 438 PGYSPSSPSSGYS---PASPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT 494 Query: 354 YPVYRGSPPTY 386 P Y + P+Y Sbjct: 495 SPSYSPTSPSY 505 >SB_6496| Best HMM Match : Collagen (HMM E-Value=0) Length = 1234 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 183 PGGTNGHPSSGGNHGYPGTGGMSGNNHGYQPKK 281 P G G P G G G+ G+ G NHG Q ++ Sbjct: 102 PNGAPGRPGVRGPKGESGSRGLPG-NHGVQGER 133 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 183 PGGTNGHPSSGGNHGYPGTGGMSG 254 PGG G P +GG G P GG G Sbjct: 239 PGGYPGAPPAGGYPGAPPPGGYPG 262 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +3 Query: 246 MSGNNHGYQPKKPAVYQYNPPQQIRYTPVGGGSPVNYPVYRGS 374 M G +G Q A Q PP P+GGG P P Y+G+ Sbjct: 258 MGGGQYGGQYMHQAP-QGGPPGYGANMPMGGGPPTAAPGYQGA 299 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,016,360 Number of Sequences: 59808 Number of extensions: 341924 Number of successful extensions: 1504 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1420 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1422302661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -