BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I23 (469 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0849 + 32433429-32433743,32433840-32434021,32434235-324343... 29 2.5 05_06_0043 + 25143513-25143866,25144010-25144191,25144284-251443... 27 7.5 11_06_0573 + 25088921-25089035,25089752-25089843,25089990-25091672 27 10.0 01_02_0134 + 11470543-11470608,11471718-11471775,11472025-114722... 27 10.0 >01_06_0849 + 32433429-32433743,32433840-32434021,32434235-32434310, 32434413-32434570,32435567-32435738,32435817-32435927, 32436197-32436280 Length = 365 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +2 Query: 323 LKQN*LCIKYEW-TIHNKWNGGNSVDGQPHICGIFHYCLLGNRCARATQF 469 LK N +C++ + I WNGG G+ +LG+ C R +F Sbjct: 89 LKLNTVCVEAQCPNIGECWNGGGGAGGEGDGIATATIMVLGDTCTRGCRF 138 >05_06_0043 + 25143513-25143866,25144010-25144191,25144284-25144374, 25144452-25144568,25144922-25144976,25145008-25145093, 25145190-25145300,25145564-25145608,25145695-25145740, 25146078-25146152,25146902-25146971,25147128-25147437, 25147778-25147851,25147996-25148151,25148416-25148539 Length = 631 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +2 Query: 323 LKQN*LCIKYEW-TIHNKWNGGNSVDGQPHICGIFHYCLLGNRCARATQF 469 LK N +C++ + I W+GG G LLG+ C R +F Sbjct: 102 LKLNTVCVEAQCPNIGECWDGGGGAGGDGDGIATATIMLLGDTCTRGCRF 151 >11_06_0573 + 25088921-25089035,25089752-25089843,25089990-25091672 Length = 629 Score = 26.6 bits (56), Expect = 10.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 463 CSPRTPIPQKTIVKNTTNMRLPVDRITSIPL 371 C PR P+ + V T R PVD +T + + Sbjct: 96 CHPRLPVLVRVAVPATAARRAPVDLVTLLDI 126 >01_02_0134 + 11470543-11470608,11471718-11471775,11472025-11472278, 11472307-11472511,11472907-11473142 Length = 272 Score = 26.6 bits (56), Expect = 10.0 Identities = 9/18 (50%), Positives = 15/18 (83%), Gaps = 2/18 (11%) Frame = -2 Query: 390 ELPPFHLLC--IVHSYFI 343 ++PPFH+LC +VH+ F+ Sbjct: 12 QMPPFHILCAKLVHAIFL 29 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,316,082 Number of Sequences: 37544 Number of extensions: 225467 Number of successful extensions: 390 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 390 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 943260316 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -