BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I23 (469 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value J03069-1|AAA59883.1| 357|Homo sapiens MYCL2 protein. 29 8.0 AC004081-1|AAB97938.1| 358|Homo sapiens WUGSC:H_DJ0320J15.1 pro... 29 8.0 >J03069-1|AAA59883.1| 357|Homo sapiens MYCL2 protein. Length = 357 Score = 29.1 bits (62), Expect = 8.0 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 2/77 (2%) Frame = -3 Query: 458 PAHTYSPEDNSEKYHKYAAARRQNYLHSTYYVL--SIHTLYTINFVLKILFHKITLEYSH 285 P H + +KYH Y +R+N S + L + L + + V K++ EY H Sbjct: 265 PIHYDTENWTKKKYHSYLERKRRNDQRSRFLALRDEVPALASCSRVSKVMILVKATEYLH 324 Query: 284 IITQCNND*FANHKRTL 234 + + + A KR L Sbjct: 325 ELAEA-EERMATEKRQL 340 >AC004081-1|AAB97938.1| 358|Homo sapiens WUGSC:H_DJ0320J15.1 protein. Length = 358 Score = 29.1 bits (62), Expect = 8.0 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 2/77 (2%) Frame = -3 Query: 458 PAHTYSPEDNSEKYHKYAAARRQNYLHSTYYVL--SIHTLYTINFVLKILFHKITLEYSH 285 P H + +KYH Y +R+N S + L + L + + V K++ EY H Sbjct: 266 PIHYDTENWTKKKYHSYLERKRRNDQRSRFLALRDEVPALASCSRVSKVMILVKATEYLH 325 Query: 284 IITQCNND*FANHKRTL 234 + + + A KR L Sbjct: 326 ELAEA-EERMATEKRQL 341 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,874,538 Number of Sequences: 237096 Number of extensions: 1342449 Number of successful extensions: 2461 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2461 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4042952858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -