BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I23 (469 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80843-16|AAB37958.1| 327|Caenorhabditis elegans Serpentine rec... 28 3.8 Z83104-7|CAH60780.1| 762|Caenorhabditis elegans Hypothetical pr... 27 5.1 Z70685-2|CAA94606.2| 762|Caenorhabditis elegans Hypothetical pr... 27 5.1 AY037802-1|AAK94767.1| 669|Caenorhabditis elegans GLY-2 protein. 27 5.1 AY037800-1|AAK94765.1| 661|Caenorhabditis elegans GLY-2 protein. 27 5.1 AF154122-1|AAF74523.1| 669|Caenorhabditis elegans N-acetylgluco... 27 5.1 AC006625-9|AAK68273.1| 669|Caenorhabditis elegans Glycosylation... 27 5.1 Z83238-8|CAB05799.2| 355|Caenorhabditis elegans Hypothetical pr... 27 8.9 Z81044-6|CAB02806.1| 360|Caenorhabditis elegans Hypothetical pr... 27 8.9 Z12017-3|CAA78049.1| 570|Caenorhabditis elegans Hypothetical pr... 27 8.9 >U80843-16|AAB37958.1| 327|Caenorhabditis elegans Serpentine receptor, class h protein274 protein. Length = 327 Score = 27.9 bits (59), Expect = 3.8 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -3 Query: 203 LTSFTLKTSKRMLTALNSQVCI*IALL 123 L+ T+K K+ L ALN Q CI +A+L Sbjct: 226 LSPQTIKMQKQFLRALNIQTCIPLAIL 252 >Z83104-7|CAH60780.1| 762|Caenorhabditis elegans Hypothetical protein R07D5.2 protein. Length = 762 Score = 27.5 bits (58), Expect = 5.1 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 368 YVLSIHTLYTINFV-LKILFHKITLEYSHIITQCNND*FANHKRT 237 Y+L HTL+TI F+ I+ IT+ Y HI + +D N RT Sbjct: 560 YLLRGHTLFTILFLSASIIIFVITVTY-HIKVRRQHDIIHNELRT 603 >Z70685-2|CAA94606.2| 762|Caenorhabditis elegans Hypothetical protein R07D5.2 protein. Length = 762 Score = 27.5 bits (58), Expect = 5.1 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 368 YVLSIHTLYTINFV-LKILFHKITLEYSHIITQCNND*FANHKRT 237 Y+L HTL+TI F+ I+ IT+ Y HI + +D N RT Sbjct: 560 YLLRGHTLFTILFLSASIIIFVITVTY-HIKVRRQHDIIHNELRT 603 >AY037802-1|AAK94767.1| 669|Caenorhabditis elegans GLY-2 protein. Length = 669 Score = 27.5 bits (58), Expect = 5.1 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +2 Query: 248 GWRTNHCYIE 277 GW+T+HCYIE Sbjct: 93 GWKTHHCYIE 102 >AY037800-1|AAK94765.1| 661|Caenorhabditis elegans GLY-2 protein. Length = 661 Score = 27.5 bits (58), Expect = 5.1 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +2 Query: 248 GWRTNHCYIE 277 GW+T+HCYIE Sbjct: 85 GWKTHHCYIE 94 >AF154122-1|AAF74523.1| 669|Caenorhabditis elegans N-acetylglucosaminyltransferase V protein. Length = 669 Score = 27.5 bits (58), Expect = 5.1 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +2 Query: 248 GWRTNHCYIE 277 GW+T+HCYIE Sbjct: 93 GWKTHHCYIE 102 >AC006625-9|AAK68273.1| 669|Caenorhabditis elegans Glycosylation related protein 2 protein. Length = 669 Score = 27.5 bits (58), Expect = 5.1 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +2 Query: 248 GWRTNHCYIE 277 GW+T+HCYIE Sbjct: 93 GWKTHHCYIE 102 >Z83238-8|CAB05799.2| 355|Caenorhabditis elegans Hypothetical protein T08G3.10 protein. Length = 355 Score = 26.6 bits (56), Expect = 8.9 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +3 Query: 231 IQCAFMVGELIIVTLSDYMTIFKCNFMKQNF*NKI-NCV*SMNG-QYIISGMEVILSTG 401 IQC V E + + + M + +C F+K KI V S NG + +IS IL +G Sbjct: 115 IQCITKVTERLAIWYAVAMAVLRCLFIKLPINKKIYGLVHSKNGIRLLISVTAAILPSG 173 >Z81044-6|CAB02806.1| 360|Caenorhabditis elegans Hypothetical protein C30H6.2 protein. Length = 360 Score = 26.6 bits (56), Expect = 8.9 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = -3 Query: 452 HTYSPEDNSEKYHKYAAARRQNYLHSTYYVLSIHTLYTINFVLKILFHKITLEY 291 H++ +D+ R+N L + VLSI+ LY + F + + K L Y Sbjct: 100 HSHHHDDSDRIMWYTVTPARKNLLRLSVIVLSIYILYFVEFFM--FYRKTHLHY 151 >Z12017-3|CAA78049.1| 570|Caenorhabditis elegans Hypothetical protein R08D7.3 protein. Length = 570 Score = 26.6 bits (56), Expect = 8.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 365 HNKWNGGNSVDGQP 406 + KWN GN VDG+P Sbjct: 382 YRKWNLGNGVDGKP 395 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,280,892 Number of Sequences: 27780 Number of extensions: 235130 Number of successful extensions: 576 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 576 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 839684522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -