BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I22 (604 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 2.0 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 6.1 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 21 6.1 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.0 AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochr... 21 8.0 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 23.0 bits (47), Expect = 2.0 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 408 LHVVWKFINIILIS 367 + VWKF NI LI+ Sbjct: 408 MRTVWKFFNIFLIT 421 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.4 bits (43), Expect = 6.1 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +1 Query: 139 CETHLAVPADRTQRRQLTNVFIMQLPQ 219 C++ +P R QRR T QL + Sbjct: 208 CDSEPGIPLKRKQRRSRTTFTAHQLDE 234 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 21.4 bits (43), Expect = 6.1 Identities = 10/40 (25%), Positives = 23/40 (57%) Frame = -3 Query: 500 WV*YKRVCNVLTRYRMSSFVSIRLM*LTITHYMLYGSLLI 381 WV ++R+ LT+ ++S F + + LT+ +L +++ Sbjct: 162 WVNFERIYYKLTKKKLSVFFGNKPVILTVVLPLLACGVMV 201 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 8.0 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +3 Query: 231 INTYYIYSIFLQSFSKL 281 + TY YS+ +Q+F+K+ Sbjct: 1066 LKTYTQYSVVVQAFNKV 1082 >AF265297-1|AAG17640.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 125 Score = 21.0 bits (42), Expect = 8.0 Identities = 10/43 (23%), Positives = 18/43 (41%) Frame = -1 Query: 196 RLLVDVAASGPRAPLGASHTDQIALSLAGHVVTFSLFIHAHRY 68 R + +V P P A + ++ +GH + +H H Y Sbjct: 49 RCIKEVLRLYPSVPFIARSLGEDIVTYSGHKLKAGSMVHLHIY 91 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,093 Number of Sequences: 336 Number of extensions: 2519 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15248386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -