BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I22 (604 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0096 + 25513535-25514024,25514139-25514236,25514395-255147... 28 5.0 07_01_0665 + 5001599-5003149 27 8.7 >05_06_0096 + 25513535-25514024,25514139-25514236,25514395-25514783, 25515485-25515599,25515816-25515917,25516584-25516734, 25517162-25517250,25517518-25517566,25517723-25517763, 25517929-25518116,25518285-25518402,25518900-25519079, 25519172-25519294,25519368-25519455,25519549-25519679, 25519768-25519866,25520822-25521253 Length = 960 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 320 AATRGVARARCFPVHRDINIILINFHTTCNALL 418 A TR +A RC PV D I+ ++ CN +L Sbjct: 188 ALTRALAEKRCIPVFLDEEIVHQYYNGYCNNIL 220 >07_01_0665 + 5001599-5003149 Length = 516 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 402 VVWKFINIILISR*TGKHRARATPRVAASAGPFTT 298 VVW + + + G+H AR R+AA P+ T Sbjct: 28 VVWNSLQSLQLHHLVGRHLARHARRLAAVVDPYLT 62 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,897,604 Number of Sequences: 37544 Number of extensions: 246699 Number of successful extensions: 532 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -