BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I21 (640 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81523-6|CAB04244.1| 2586|Caenorhabditis elegans Hypothetical pr... 30 1.6 AF067937-7|AAN84819.1| 392|Caenorhabditis elegans Hypothetical ... 29 2.8 AF067937-6|AAF99915.1| 426|Caenorhabditis elegans Hypothetical ... 29 2.8 Z81039-7|CAB02778.1| 60|Caenorhabditis elegans Hypothetical pr... 28 6.5 >Z81523-6|CAB04244.1| 2586|Caenorhabditis elegans Hypothetical protein F32H2.5 protein. Length = 2586 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +3 Query: 183 IGSLDLTNRQKLGAATAGVALDNVNGHGVSLTDTHIPGFGD 305 IG +DL+ LG A LDNV+ HG+ L P GD Sbjct: 1832 IGKVDLSQNSSLGMAKL---LDNVSVHGILLDSIMDPTVGD 1869 >AF067937-7|AAN84819.1| 392|Caenorhabditis elegans Hypothetical protein F22F7.1b protein. Length = 392 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +3 Query: 135 GVKVPFAGNDKNIVSAIGSLDLTNRQ 212 GV VPF G DK+I++ D T+RQ Sbjct: 237 GVAVPFPGADKSIINRSQYYDATSRQ 262 >AF067937-6|AAF99915.1| 426|Caenorhabditis elegans Hypothetical protein F22F7.1a protein. Length = 426 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +3 Query: 135 GVKVPFAGNDKNIVSAIGSLDLTNRQ 212 GV VPF G DK+I++ D T+RQ Sbjct: 237 GVAVPFPGADKSIINRSQYYDATSRQ 262 >Z81039-7|CAB02778.1| 60|Caenorhabditis elegans Hypothetical protein C25D7.9 protein. Length = 60 Score = 27.9 bits (59), Expect = 6.5 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 365 RCGVVVIVVEEIHFAGSCHLVSEPGDVCIRETYSVAVYII-QCHSSGCSA 219 R GV V +E+I +G C +S P VC+ T + + ++ Q +S+ SA Sbjct: 11 RWGVSVDALEKIIDSGVCPRLSSPQIVCVWPTTTQHILLVAQTNSTSVSA 60 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,492,859 Number of Sequences: 27780 Number of extensions: 316666 Number of successful extensions: 877 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 875 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -