BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I18 (593 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 4.5 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 5.9 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 7.8 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 7.8 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 4.5 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -2 Query: 337 IANPDPFFSQPSNGPSGNYEPISTGPAFVDFN 242 I NP P + PSN + S P D N Sbjct: 416 IINPQPQITSPSNTNTSTSSTNSNKPNSSDLN 447 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 5.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 470 CRIRHEETTLTLFDNESFRVFLLR 399 C HE+ T ++DNE F R Sbjct: 803 CDFLHEDNTTLVWDNEQQVPFAYR 826 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 7.8 Identities = 12/47 (25%), Positives = 20/47 (42%) Frame = -1 Query: 566 HSTISSHALPA*KYSEYXIDELHFHRATISPSCRIRHEETTLTLFDN 426 H +++H +EY L TI+P+ I E+T + N Sbjct: 1561 HLRVTAHNNAGFNVAEYEFATLTVTGGTIAPAREIPKEDTFQIILAN 1607 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.0 bits (42), Expect = 7.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 503 VHLYXIHYIFKLEER 547 ++LY I+Y FK ER Sbjct: 120 INLYTINYNFKESER 134 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,925 Number of Sequences: 336 Number of extensions: 2630 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -