BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I18 (593 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces... 28 0.89 SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizos... 26 3.6 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 26 4.8 SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 26 4.8 SPBPB2B2.01 |||amino acid permease, unknown 12|Schizosaccharomyc... 25 6.3 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 25 6.3 SPAC11D3.14c |||oxoprolinase |Schizosaccharomyces pombe|chr 1|||... 25 8.3 >SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces pombe|chr 1|||Manual Length = 576 Score = 28.3 bits (60), Expect = 0.89 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 370 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPI 272 V DG + VVI P F+ P+N S N+ P+ Sbjct: 405 VTGDGEAKQVVITMPSTHFT-PANNSSANHSPL 436 >SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1338 Score = 26.2 bits (55), Expect = 3.6 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -2 Query: 346 HVVIANPDPFFSQPSNGPSGNY-EPISTGPAF-VDFNHPNYPPKRYDNP 206 HV ++NPD P + S NY P+ A +F+ P + +Y +P Sbjct: 478 HVSLSNPDFAIGSPMSQDSSNYSSPLHRRKASDSNFSDPRFDDLKYLSP 526 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 25.8 bits (54), Expect = 4.8 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 4/29 (13%) Frame = -2 Query: 319 FFSQPSNGP----SGNYEPISTGPAFVDF 245 F + P+N P SG+Y PI P F F Sbjct: 1560 FVTPPTNSPYAEVSGDYNPIHVSPTFAAF 1588 >SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 422 Score = 25.8 bits (54), Expect = 4.8 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = -2 Query: 289 GNYEPI--STGPAFVDFNHPNYPPKRYDNPLAR 197 G+Y P ST P + +P+YPP Y AR Sbjct: 117 GSYPPTQPSTQPLPQSYGYPSYPPAGYRGGSAR 149 >SPBPB2B2.01 |||amino acid permease, unknown 12|Schizosaccharomyces pombe|chr 2|||Manual Length = 585 Score = 25.4 bits (53), Expect = 6.3 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 365 WNSVCGSHGQYGEEEKHESFHCRIVSELSP 454 W S+C +H +Y KH++ + V +SP Sbjct: 449 WGSICLAHIRYRAAMKHQNRSLKEVGFVSP 478 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 25.4 bits (53), Expect = 6.3 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -2 Query: 313 SQPSNGPSGNYEPISTGPAFVDFNHPNYPP 224 S P N P P+S PA + P PP Sbjct: 265 SSPPNSPPRPIAPVSMNPAINSTSKPPLPP 294 >SPAC11D3.14c |||oxoprolinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1260 Score = 25.0 bits (52), Expect = 8.3 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 380 GSHGQYGEEEKHESFHCRIVSELSPRAEFG 469 G G E S HC I+SE RA +G Sbjct: 1174 GGDGVIRHFEFRRSMHCSILSERRSRAPYG 1203 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,230,090 Number of Sequences: 5004 Number of extensions: 41642 Number of successful extensions: 102 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 258201856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -