BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I14 (473 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g55350.4 68414.m06326 calpain-type cysteine protease family i... 29 2.1 At1g55350.3 68414.m06325 calpain-type cysteine protease family i... 29 2.1 At1g55350.2 68414.m06324 calpain-type cysteine protease family i... 29 2.1 At1g55350.1 68414.m06323 calpain-type cysteine protease family i... 29 2.1 At1g77520.1 68414.m09027 O-methyltransferase family 2 protein si... 27 4.9 At1g50980.1 68414.m05731 F-box family protein contains F-box dom... 27 6.5 >At1g55350.4 68414.m06326 calpain-type cysteine protease family identical to calpain-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain family cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 Length = 2151 Score = 28.7 bits (61), Expect = 2.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 139 PPLRGFALWLQTTLGAGRPVTLHGIVTSCP 50 P ++GF LW+ L AG ++L I+++ P Sbjct: 757 PRIKGFILWICVVLFAGSVISLGAIISAKP 786 >At1g55350.3 68414.m06325 calpain-type cysteine protease family identical to calpain-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain family cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 Length = 2151 Score = 28.7 bits (61), Expect = 2.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 139 PPLRGFALWLQTTLGAGRPVTLHGIVTSCP 50 P ++GF LW+ L AG ++L I+++ P Sbjct: 757 PRIKGFILWICVVLFAGSVISLGAIISAKP 786 >At1g55350.2 68414.m06324 calpain-type cysteine protease family identical to calpain-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain family cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 Length = 2151 Score = 28.7 bits (61), Expect = 2.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 139 PPLRGFALWLQTTLGAGRPVTLHGIVTSCP 50 P ++GF LW+ L AG ++L I+++ P Sbjct: 757 PRIKGFILWICVVLFAGSVISLGAIISAKP 786 >At1g55350.1 68414.m06323 calpain-type cysteine protease family identical to calpain-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain family cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 Length = 2151 Score = 28.7 bits (61), Expect = 2.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 139 PPLRGFALWLQTTLGAGRPVTLHGIVTSCP 50 P ++GF LW+ L AG ++L I+++ P Sbjct: 757 PRIKGFILWICVVLFAGSVISLGAIISAKP 786 >At1g77520.1 68414.m09027 O-methyltransferase family 2 protein similar to caffeic acid 3-O-methyltransferase GB:O23760 [Clarkia breweri], [SP|Q00763] [Populus tremuloides] Length = 381 Score = 27.5 bits (58), Expect = 4.9 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 241 YLSPCSLVALQP*YPVSPFCTPLMTRPLSLTVA 143 +LSPC + P P +P L+ R LSL V+ Sbjct: 66 WLSPCEIACSLPTKPTNPEAPVLLDRMLSLLVS 98 >At1g50980.1 68414.m05731 F-box family protein contains F-box domain Pfam:PF00646 Length = 370 Score = 27.1 bits (57), Expect = 6.5 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -2 Query: 172 MTRPLSLTVALPPLRGFALWLQTTLGAGRPVTLHGIVTSCP 50 +T + T+ +P LR L + T G RP +HG V + P Sbjct: 164 LTNVMIFTIDVPTLR--ILSIDNTSGKSRPKGVHGFVINTP 202 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,976,822 Number of Sequences: 28952 Number of extensions: 167473 Number of successful extensions: 400 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 400 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 811731120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -