BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I10 (589 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 22 3.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 5.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 5.8 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +2 Query: 323 KGLDVDRLVIDHIQVNRAPCLRRRTYRAHGRI 418 +G+D+ R++ + +Q N A C ++ A+ I Sbjct: 56 QGVDLKRVLPEALQTNCAKCTEKQRTAAYRSI 87 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 4.4 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 119 RKLPLRRAVRYLKNVTEKKECIPFR 193 R LPLR AV ++ ++ +P R Sbjct: 59 RALPLRSAVEHIPDLIADSRRLPLR 83 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 63 RALHDLAGLSGSRE*RPIFY 4 + + +LA SG E +PIFY Sbjct: 1370 KTVSNLAQTSGGGENKPIFY 1389 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 63 RALHDLAGLSGSRE*RPIFY 4 + + +LA SG E +PIFY Sbjct: 1370 KTVSNLAQTSGGGENKPIFY 1389 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,680 Number of Sequences: 336 Number of extensions: 2535 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14726181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -