BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I10 (589 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal p... 25 1.4 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 5.5 DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 23 7.3 >X98186-1|CAA66861.1| 269|Anopheles gambiae put. S3a ribosomal protein homologue protein. Length = 269 Score = 25.4 bits (53), Expect = 1.4 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 202 VKTTEGNAFLLFCHIL*VTDSTAKRQFSYSHGSFI 98 VKTT+G +FC + DS ++R+ Y+ S I Sbjct: 130 VKTTDGFMLRVFCIGFTIKDSMSQRKTCYAQHSQI 164 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 5.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 221 HNGQLHR*NDGRECIPSFLSHSLGNG 144 H G L+ + P FL H+ GNG Sbjct: 821 HKGNLNDTEVQKSLPPKFLIHTFGNG 846 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +2 Query: 77 RVHFKNTYETAMAIRKLPLRR 139 R+H NTY+ A+++L +R+ Sbjct: 368 RMHASNTYDLKAALQQLGVRK 388 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 540,445 Number of Sequences: 2352 Number of extensions: 11829 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -