BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I09 (422 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X13382-1|CAA31759.1| 407|Drosophila melanogaster protein ( Dros... 59 3e-09 AY069485-1|AAL39630.1| 401|Drosophila melanogaster LD21756p pro... 59 3e-09 AE014297-4196|AAG22173.1| 401|Drosophila melanogaster CG5502-PA... 59 3e-09 AE014134-3330|AAX52672.1| 389|Drosophila melanogaster CG33511-P... 27 7.8 >X13382-1|CAA31759.1| 407|Drosophila melanogaster protein ( Drosophila melanogastermRNA for put. ribosomal protein L1. ). Length = 407 Score = 58.8 bits (136), Expect = 3e-09 Identities = 25/53 (47%), Positives = 39/53 (73%) Frame = +3 Query: 3 RKLNPLTNTKAMLKLNPYAAVLRRKAVLEQVRRNNLRALAVAEKRGIKLPETH 161 R+LNPLTN + ++KLNPYA VL+R+A L +R + LA A+K+ ++L ++H Sbjct: 317 RRLNPLTNVRQLIKLNPYAEVLKRRAALAAEKRTVAKVLAKAKKQNVELAKSH 369 >AY069485-1|AAL39630.1| 401|Drosophila melanogaster LD21756p protein. Length = 401 Score = 58.8 bits (136), Expect = 3e-09 Identities = 25/53 (47%), Positives = 39/53 (73%) Frame = +3 Query: 3 RKLNPLTNTKAMLKLNPYAAVLRRKAVLEQVRRNNLRALAVAEKRGIKLPETH 161 R+LNPLTN + ++KLNPYA VL+R+A L +R + LA A+K+ ++L ++H Sbjct: 317 RRLNPLTNVRQLIKLNPYAEVLKRRAALAAEKRTVAKVLAKAKKQNVELAKSH 369 >AE014297-4196|AAG22173.1| 401|Drosophila melanogaster CG5502-PA protein. Length = 401 Score = 58.8 bits (136), Expect = 3e-09 Identities = 25/53 (47%), Positives = 39/53 (73%) Frame = +3 Query: 3 RKLNPLTNTKAMLKLNPYAAVLRRKAVLEQVRRNNLRALAVAEKRGIKLPETH 161 R+LNPLTN + ++KLNPYA VL+R+A L +R + LA A+K+ ++L ++H Sbjct: 317 RRLNPLTNVRQLIKLNPYAEVLKRRAALAAEKRTVAKVLAKAKKQNVELAKSH 369 >AE014134-3330|AAX52672.1| 389|Drosophila melanogaster CG33511-PA protein. Length = 389 Score = 27.5 bits (58), Expect = 7.8 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +3 Query: 9 LNPLTNTKAMLKLNPYAAVLRRKAVLEQVRRNNLRALAVAEKRGIKLPETHPAV 170 L LT L+ N Y + K VLE + + ++A EK +K+ E++ V Sbjct: 124 LEDLTQDYRHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNV 177 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,268,840 Number of Sequences: 53049 Number of extensions: 143317 Number of successful extensions: 790 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 790 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1292733852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -