BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I06 (483 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 24 0.85 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 2.6 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 21 4.5 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 21 4.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.0 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 23.8 bits (49), Expect = 0.85 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -1 Query: 444 CSTGSTPGKDCHVTCNQLLTDDISVAATCAKKI 346 C G T GK CH N + TC KI Sbjct: 56 CQPGFT-GKYCHENINDCKVNPCENGGTCVDKI 87 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.2 bits (45), Expect = 2.6 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +2 Query: 152 FLNISIMHNILINIFVLNYN 211 ++N + +LIN++ +NYN Sbjct: 109 YVNKAKFGKLLINLYTINYN 128 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 21.4 bits (43), Expect = 4.5 Identities = 11/45 (24%), Positives = 23/45 (51%) Frame = -1 Query: 252 NFIKQLLMKFTSSQL*FKTKMFIRILCIILMFKKRKSSRNSWQIS 118 NF+K L+ + + F +FI ++ +++ K R+ QI+ Sbjct: 36 NFVKTYLVSDFENYVTFFCSLFIVVILKLILAKYRQQDVTLLQIT 80 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 21.4 bits (43), Expect = 4.5 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -2 Query: 116 TTISSVQLSKAFVFLQKY 63 T + ++L K F F+ KY Sbjct: 164 TDLQRIELEKEFTFVSKY 181 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -1 Query: 480 DYGLFQINDKYWCSTGSTPGK 418 DY + YW G+ PGK Sbjct: 2538 DYFNANFSLNYWIEKGADPGK 2558 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,654 Number of Sequences: 336 Number of extensions: 2263 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11352204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -