BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I05 (586 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24C9.07c |bgs2|meu21, pgs2|1,3-beta-glucan synthase subunit ... 26 4.7 SPCC320.05 |||sulphate transporter |Schizosaccharomyces pombe|ch... 25 6.2 SPCC16C4.08c |skb15||Shk1 kinase binding protein 15|Schizosaccha... 25 6.2 SPAC22H10.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 8.1 >SPAC24C9.07c |bgs2|meu21, pgs2|1,3-beta-glucan synthase subunit Bgs2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1894 Score = 25.8 bits (54), Expect = 4.7 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -2 Query: 258 WHSKLLAVFDGGQPETEFICKVMASTTFTVTFY 160 W+S+ L QP E ICK+ F F+ Sbjct: 1748 WYSRGLGFHALSQPSRELICKMTELNFFAADFF 1780 >SPCC320.05 |||sulphate transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 667 Score = 25.4 bits (53), Expect = 6.2 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -3 Query: 260 SGIANCWLSSMVVSQKLSLFA 198 S + C L+SMVVS +SLFA Sbjct: 426 STVPTCMLASMVVSLGVSLFA 446 >SPCC16C4.08c |skb15||Shk1 kinase binding protein 15|Schizosaccharomyces pombe|chr 3|||Manual Length = 341 Score = 25.4 bits (53), Expect = 6.2 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 324 FDTNCTSGYTF*ETSRLKCLSLWHSKLLAVFDGG 223 F + TS ++F S+L L L+ SKL+ D G Sbjct: 186 FKLDLTSLFSFSSKSQLNALCLYQSKLIVGRDNG 219 >SPAC22H10.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 646 Score = 25.0 bits (52), Expect = 8.1 Identities = 12/46 (26%), Positives = 25/46 (54%) Frame = -1 Query: 268 SVALA*QTVGCLRWWSARN*VYLQSDGKYHLHRYIL*MVSLGNLLN 131 S+ + QT+ ++ S+ + +Y + DG YH +L ++ + LN Sbjct: 190 SLKIILQTIDLFKYDSSFSSIYFRKDGPYHKVEKLLKSANIRSSLN 235 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,400,802 Number of Sequences: 5004 Number of extensions: 46584 Number of successful extensions: 80 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 252150250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -