BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_I05 (586 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g12990.1 68414.m01508 glycosyl transferase family 17 protein ... 30 0.99 >At1g12990.1 68414.m01508 glycosyl transferase family 17 protein low similarity to beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC 2.4.1.144) from Mus musculus [SP|Q10470], Rattus norvegicus [SP|Q02527], Homo sapiens [SP|Q09327]; contains Pfam profile PF04724 :Glycosyltransferase family 17 Length = 392 Score = 30.3 bits (65), Expect = 0.99 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -3 Query: 254 IANCWLSSMVVSQKLSLFAK*-WQVPPSPLHSINGIARKSSKQE 126 + C L+ V QK+S F + W+ PP P H I +++ E Sbjct: 57 VPTCVLAGYVHGQKISYFLRPLWESPPKPFHDIPHYYHENASME 100 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,290,475 Number of Sequences: 28952 Number of extensions: 234233 Number of successful extensions: 443 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 443 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -