SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0002_I05
         (586 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g12990.1 68414.m01508 glycosyl transferase family 17 protein ...    30   0.99 

>At1g12990.1 68414.m01508 glycosyl transferase family 17 protein low
           similarity to beta-1,4-mannosyl-glycoprotein
           beta-1,4-N-acetylglucosaminyltransferase (EC 2.4.1.144)
           from Mus musculus [SP|Q10470], Rattus norvegicus
           [SP|Q02527], Homo sapiens [SP|Q09327]; contains Pfam
           profile PF04724 :Glycosyltransferase family 17
          Length = 392

 Score = 30.3 bits (65), Expect = 0.99
 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
 Frame = -3

Query: 254 IANCWLSSMVVSQKLSLFAK*-WQVPPSPLHSINGIARKSSKQE 126
           +  C L+  V  QK+S F +  W+ PP P H I     +++  E
Sbjct: 57  VPTCVLAGYVHGQKISYFLRPLWESPPKPFHDIPHYYHENASME 100


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,290,475
Number of Sequences: 28952
Number of extensions: 234233
Number of successful extensions: 443
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 436
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 443
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1151426952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -