Samia BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0002_I04
         (642 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   3.7  
AM292326-1|CAL23138.2|  522|Tribolium castaneum gustatory recept...    22   3.7  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 7/15 (46%), Positives = 9/15 (60%)
 Frame = +2

Query: 17   CVSKEAGHQTSAESW 61
            C  K+ GH+ S  SW
Sbjct: 1152 CEEKKPGHKPSTSSW 1166


>AM292326-1|CAL23138.2|  522|Tribolium castaneum gustatory receptor
           candidate 5 protein.
          Length = 522

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 12/36 (33%), Positives = 19/36 (52%)
 Frame = -1

Query: 591 PPGASFRRFSLFTLSISMPGMLRNARVRPLSLL*MI 484
           P G S     LFTL +++ G+ R    + LS + +I
Sbjct: 30  PKGYSLLWILLFTLGVTISGVYRTDFYKKLSPMRLI 65


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,637
Number of Sequences: 336
Number of extensions: 2535
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16448590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)