BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_H24 (284 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF205888-1|AAF22799.1| 777|Homo sapiens AXIN2 protein. 29 2.7 BC020264-1|AAH20264.1| 406|Homo sapiens HERPUD family member 2 ... 27 8.3 BC005091-1|AAH05091.1| 406|Homo sapiens HERPUD2 protein protein. 27 8.3 AK125990-1|BAC86379.1| 1205|Homo sapiens protein ( Homo sapiens ... 27 8.3 AB037831-1|BAA92648.2| 4355|Homo sapiens KIAA1410 protein protein. 27 8.3 >AF205888-1|AAF22799.1| 777|Homo sapiens AXIN2 protein. Length = 777 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = +2 Query: 17 CSGRSSFYCLSLCASAFKADT*LSANLFTIFNTMRSLNY*QALESAGTR 163 C G S +YC S C S KA + + F +T ++ A S G R Sbjct: 542 CPGGSEYYCYSKCKSHSKAPETMPSEQFGAQSTKKAYPLESARSSPGER 590 >BC020264-1|AAH20264.1| 406|Homo sapiens HERPUD family member 2 protein. Length = 406 Score = 27.5 bits (58), Expect = 8.3 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +1 Query: 124 PELLTSSRVRRDAHGALTLKSNSTSG-AGVQVPFAGYDKNIVCAIGS 261 P S R++H ALT SNS+S +G P +G + + A+GS Sbjct: 91 PPSSPKSSTNRESHEALTSSSNSSSDHSGSTTPSSG-QETLSLAVGS 136 >BC005091-1|AAH05091.1| 406|Homo sapiens HERPUD2 protein protein. Length = 406 Score = 27.5 bits (58), Expect = 8.3 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +1 Query: 124 PELLTSSRVRRDAHGALTLKSNSTSG-AGVQVPFAGYDKNIVCAIGS 261 P S R++H ALT SNS+S +G P +G + + A+GS Sbjct: 91 PPSSPKSSTNRESHEALTSSSNSSSDHSGSTTPSSG-QETLSLAVGS 136 >AK125990-1|BAC86379.1| 1205|Homo sapiens protein ( Homo sapiens cDNA FLJ44002 fis, clone TESTI4022873. ). Length = 1205 Score = 27.5 bits (58), Expect = 8.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 15 HVREDRLFIACRSVRRRSKPIPDCQRTCLLYS 110 HV R VRR K + DCQ+ +LY+ Sbjct: 966 HVEISRAHEIANEVRRVKKQLKDCQQLAMLYN 997 >AB037831-1|BAA92648.2| 4355|Homo sapiens KIAA1410 protein protein. Length = 4355 Score = 27.5 bits (58), Expect = 8.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 15 HVREDRLFIACRSVRRRSKPIPDCQRTCLLYS 110 HV R VRR K + DCQ+ +LY+ Sbjct: 991 HVEISRAHEIANEVRRVKKQLKDCQQLAMLYN 1022 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,060,286 Number of Sequences: 237096 Number of extensions: 632102 Number of successful extensions: 1429 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1429 length of database: 76,859,062 effective HSP length: 71 effective length of database: 60,025,246 effective search space used: 1380580658 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -