BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_H20 (571 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.8 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.8 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 23 2.8 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 22 4.9 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 8.6 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 413 SSIVIFPLCLMFFCFLRSR 357 SS VIF + + F FLR+R Sbjct: 14 SSCVIFGVLFVLFSFLRTR 32 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 413 SSIVIFPLCLMFFCFLRSR 357 SS VIF + + F FLR+R Sbjct: 14 SSCVIFGVLFVLFSFLRTR 32 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 22.6 bits (46), Expect = 2.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 281 TINWTVILRPFQSLVALAMSSPTFFG 204 +I VIL F + AL++S P FG Sbjct: 11 SIRHAVILASFVWIYALSLSLPPLFG 36 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +1 Query: 361 DRKKQKNIKHNGNITMEDVIGIAKIMRP 444 +++ ++ + G + ME+ + AK MRP Sbjct: 182 EQEAKRRFEKYGQLFMEETLKAAKRMRP 209 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/40 (30%), Positives = 15/40 (37%) Frame = +3 Query: 393 WKYHNGRCHWHCQDNASSFNGTLPLRLSKRNPWHSTICWM 512 W + R H Q F LP L R P + + WM Sbjct: 320 WNFRGPRTHRMPQLIRKIFLKYLPTILMMRRPKKTRLRWM 359 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,796 Number of Sequences: 438 Number of extensions: 3114 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -