BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_H10 (705 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50960.1 68418.m06320 nucleotide-binding family protein simil... 324 3e-89 At4g19540.1 68417.m02874 expressed protein 147 5e-36 At3g24430.1 68416.m03066 expressed protein contains Pfam profile... 130 9e-31 At5g24020.1 68418.m02822 septum site-determining protein (MIND) ... 36 0.035 At1g12280.1 68414.m01420 disease resistance protein (CC-NBS-LRR ... 34 0.11 At5g63020.1 68418.m07906 disease resistance protein (CC-NBS-LRR ... 32 0.32 At5g05000.3 68418.m00531 translocate of chloroplast 34 (TOC34) /... 32 0.32 At5g05000.2 68418.m00530 translocate of chloroplast 34 (TOC34) /... 32 0.32 At5g05000.1 68418.m00529 translocate of chloroplast 34 (TOC34) /... 32 0.32 At1g02280.1 68414.m00169 GTP-binding protein (TOC33) identical t... 31 0.56 At5g47250.1 68418.m05826 disease resistance protein (CC-NBS-LRR ... 31 0.98 At4g10710.1 68417.m01751 transcriptional regulator-related simil... 31 0.98 At3g54950.1 68416.m06092 patatin-related low similarity to patat... 31 0.98 At1g01910.2 68414.m00109 anion-transporting ATPase, putative sim... 31 0.98 At1g01910.1 68414.m00108 anion-transporting ATPase, putative sim... 31 0.98 At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 30 1.7 At5g43470.2 68418.m05315 disease resistance protein (CC-NBS-LRR ... 30 1.7 At5g43470.1 68418.m05314 disease resistance protein (CC-NBS-LRR ... 30 1.7 At5g27710.1 68418.m03324 expressed protein 30 1.7 At3g10350.1 68416.m01241 anion-transporting ATPase family protei... 30 1.7 At5g25930.1 68418.m03081 leucine-rich repeat family protein / pr... 29 4.0 At2g16790.1 68415.m01925 shikimate kinase family protein similar... 29 4.0 At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related conta... 28 5.2 At4g02510.1 68417.m00343 chloroplast outer membrane protein, put... 28 5.2 At3g16300.1 68416.m02057 integral membrane family protein contai... 28 5.2 At2g43400.1 68415.m05394 electron transfer flavoprotein-ubiquino... 28 5.2 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 28 5.2 At1g02530.1 68414.m00204 multidrug resistance P-glycoprotein, pu... 28 5.2 At5g59120.1 68418.m07409 subtilase family protein contains simil... 28 6.9 At5g40470.1 68418.m04908 expressed protein 28 6.9 At4g31530.1 68417.m04477 expressed protein 28 6.9 At3g45090.2 68416.m04862 2-phosphoglycerate kinase-related conta... 28 6.9 At3g45090.1 68416.m04863 2-phosphoglycerate kinase-related conta... 28 6.9 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 28 6.9 At1g56520.1 68414.m06499 disease resistance protein (TIR-NBS-LRR... 28 6.9 At1g02520.1 68414.m00203 multidrug resistance P-glycoprotein, pu... 28 6.9 At5g05400.1 68418.m00582 disease resistance protein (CC-NBS-LRR ... 27 9.2 At3g54540.1 68416.m06035 ABC transporter family protein similar ... 27 9.2 At3g24255.1 68416.m03045 expressed protein 27 9.2 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 27 9.2 At3g05780.1 68416.m00649 Lon protease, putative similar to Lon p... 27 9.2 At2g04040.1 68415.m00385 MATE efflux family protein contains Pfa... 27 9.2 At1g69295.1 68414.m07947 beta-1,3-glucanase-related low similari... 27 9.2 At1g67890.1 68414.m07752 protein kinase family protein contains ... 27 9.2 At1g53350.1 68414.m06048 disease resistance protein (CC-NBS-LRR ... 27 9.2 At1g02020.2 68414.m00122 nitroreductase family protein contains ... 27 9.2 At1g02020.1 68414.m00121 nitroreductase family protein contains ... 27 9.2 >At5g50960.1 68418.m06320 nucleotide-binding family protein similar to Nucleotide-binding protein 1 (NBP 1) (SP:Q9R060) [Mus musculus]; contains Pfam PF00991 : ParA family ATPase Length = 350 Score = 324 bits (796), Expect = 3e-89 Identities = 145/231 (62%), Positives = 183/231 (79%) Frame = +1 Query: 1 DNAPQHCPGTQSEDAGKASACAGCPNQNLCASGEASRPDPAIEIIKNRLSNVKHKILVLS 180 ++A +HCPG QSE AGK+ +CAGCPNQ CA+ PDP + I R+S VKHKILVLS Sbjct: 8 EDANEHCPGPQSESAGKSDSCAGCPNQEACATAPKG-PDPDLVAIAERMSTVKHKILVLS 66 Query: 181 GKGGVGKSTVTSLLGHGLAARTPYVNVGILDADICGPSQPRVLGVRGEQVHNSGSGWSPV 360 GKGGVGKST ++ L LA VG++D DICGPS P++LG+ G+++H S GWSPV Sbjct: 67 GKGGVGKSTFSAQLSFALAGMDH--QVGLMDIDICGPSIPKMLGLEGQEIHQSNLGWSPV 124 Query: 361 YVTENLSLMSIGFLLGSADDAVIWRGPKKNGMIKQFLSEVDWGELDYLLIDTPPGTSDEH 540 YV +NL +MSIGF+L ++D+AVIWRGP+KNG+IKQFL +V WGE+DYL++D PPGTSDEH Sbjct: 125 YVEDNLGVMSIGFMLPNSDEAVIWRGPRKNGLIKQFLKDVYWGEIDYLVVDAPPGTSDEH 184 Query: 541 LSSVQYLSSAGLTGAVVVTTPQEVALLDVRKEIQFCEKVSVPVLGVVENMS 693 +S VQYL G+ GA++VTTPQEV+L+DVRKE+ FC+KV VPVLGVVENMS Sbjct: 185 ISIVQYLLPTGIDGAIIVTTPQEVSLIDVRKEVSFCKKVGVPVLGVVENMS 235 >At4g19540.1 68417.m02874 expressed protein Length = 313 Score = 147 bits (357), Expect = 5e-36 Identities = 81/188 (43%), Positives = 111/188 (59%) Frame = +1 Query: 142 RLSNVKHKILVLSGKGGVGKSTVTSLLGHGLAARTPYVNVGILDADICGPSQPRVLGVRG 321 RL VK I V SGKGGVGKS+ L LA + + +G+LDAD+ GPS P ++ + Sbjct: 38 RLHGVKDIIAVASGKGGVGKSSTAVNLAVALANKCE-LKIGLLDADVYGPSVPIMMNINQ 96 Query: 322 EQVHNSGSGWSPVYVTENLSLMSIGFLLGSADDAVIWRGPKKNGMIKQFLSEVDWGELDY 501 + N PV + MS+G L+ D ++WRGP + + VDWG+LD Sbjct: 97 KPQVNQDMKMIPVE-NYGVKCMSMGLLV-EKDAPLVWRGPMVMSALAKMTKGVDWGDLDI 154 Query: 502 LLIDTPPGTSDEHLSSVQYLSSAGLTGAVVVTTPQEVALLDVRKEIQFCEKVSVPVLGVV 681 L++D PPGT D +S Q L L+GAV+V+TPQ+VAL D + I +KV VP+LG+V Sbjct: 155 LVVDMPPGTGDAQISISQNLK---LSGAVIVSTPQDVALADANRGISMFDKVRVPILGLV 211 Query: 682 ENMSLFIC 705 ENMS F+C Sbjct: 212 ENMSCFVC 219 >At3g24430.1 68416.m03066 expressed protein contains Pfam profile PF01883: Domain of unknown function Length = 532 Score = 130 bits (314), Expect = 9e-31 Identities = 77/185 (41%), Positives = 105/185 (56%) Frame = +1 Query: 145 LSNVKHKILVLSGKGGVGKSTVTSLLGHGLAARTPYVNVGILDADICGPSQPRVLGVRGE 324 LS + + I V S KGGVGKSTV L + LA VGI DAD+ GPS P ++ Sbjct: 172 LSRISNIIAVSSCKGGVGKSTVAVNLAYTLAGMG--ARVGIFDADVYGPSLPTMVNPES- 228 Query: 325 QVHNSGSGWSPVYVTENLSLMSIGFLLGSADDAVIWRGPKKNGMIKQFLSEVDWGELDYL 504 ++ + TE + + + F A++ RGP +G+I Q L+ +WGELDYL Sbjct: 229 RILEMNPEKKTIIPTEYMGVKLVSFGFAGQGRAIM-RGPMVSGVINQLLTTTEWGELDYL 287 Query: 505 LIDTPPGTSDEHLSSVQYLSSAGLTGAVVVTTPQEVALLDVRKEIQFCEKVSVPVLGVVE 684 +ID PPGT D L+ Q A LT AV+VTTPQ++A +DV K ++ K+ VP + VVE Sbjct: 288 VIDMPPGTGDIQLTLCQV---APLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVE 344 Query: 685 NMSLF 699 NM F Sbjct: 345 NMCHF 349 >At5g24020.1 68418.m02822 septum site-determining protein (MIND) identical to MinD [Arabidopsis thaliana] GI:6759277; contains Pfam PF00991 : ParA family ATPase Length = 326 Score = 35.5 bits (78), Expect = 0.035 Identities = 42/160 (26%), Positives = 70/160 (43%), Gaps = 7/160 (4%) Frame = +1 Query: 166 ILVLSGKGGVGKSTVTSLLGHGLAARTPYVNVGILDADICGPSQPRVLGVRGE------Q 327 +++ SGKGGVGK+T T+ +G L AR + +V +DAD+ + +LG+ + Sbjct: 61 VVITSGKGGVGKTTTTANVGLSL-ARYGF-SVVAIDADLGLRNLDLLLGLENRVNYTCVE 118 Query: 328 VHNSGSGWSPVYVTE-NLSLMSIGFLLGSADDAVIWRGPKKNGMIKQFLSEVDWGELDYL 504 V N V + S + + + G K + L G D++ Sbjct: 119 VINGDCRLDQALVRDKRWSNFELLCISKPRSKLPMGFGGKALEWLVDALKTRPEGSPDFI 178 Query: 505 LIDTPPGTSDEHLSSVQYLSSAGLTGAVVVTTPQEVALLD 624 +ID P G ++++ + AV+VTTP AL D Sbjct: 179 IIDCPAGIDAGFITAITPANE-----AVLVTTPDITALRD 213 >At1g12280.1 68414.m01420 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 894 Score = 33.9 bits (74), Expect = 0.11 Identities = 26/95 (27%), Positives = 44/95 (46%) Frame = +1 Query: 124 IEIIKNRLSNVKHKILVLSGKGGVGKSTVTSLLGHGLAARTPYVNVGILDADICGPSQPR 303 +E + RL+ +I+ L G GGVGK+T+ + + + + + V I P R Sbjct: 164 LERVWTRLTEDGDEIVGLYGMGGVGKTTLLTRINNKFSEKCSGFGVVIWVVVSKSPDIHR 223 Query: 304 VLGVRGEQVHNSGSGWSPVYVTENLSLMSIGFLLG 408 + G G+++ G W V EN + I +LG Sbjct: 224 IQGDIGKRLDLGGEEWD--NVNENQRALDIYNVLG 256 >At5g63020.1 68418.m07906 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 888 Score = 32.3 bits (70), Expect = 0.32 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +1 Query: 115 DPAIEIIKNRLSNVKHKILVLSGKGGVGKSTVTS 216 DP +E NRL + IL L G GGVGK+T+ S Sbjct: 159 DPMLESAWNRLMEDEIGILGLHGMGGVGKTTLLS 192 >At5g05000.3 68418.m00531 translocate of chloroplast 34 (TOC34) / GTP-binding protein (OEP34) contains Pfam PF04548: AIG1 family;contains TIGRFAM TIGR00991: GTP-binding protein and TIGR00231: small GTP-binding protein domain; 99.7% identical to atToc34 protein (GI:11557975) [Arabidopsis thaliana]; similar to Chain A, Pea Toc34 - A Novel Gtpase Of The Chloroplast Protein Translocon (GI:1865556) [Pisum sativum]; almost identical to SP:Q38906 Translocase of chloroplast 34; identical to cDNA GTP-binding protein (OEP34) GI:1151243 Length = 313 Score = 32.3 bits (70), Expect = 0.32 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 2/50 (4%) Frame = +1 Query: 124 IEII-KNRLSNVKHKILVLSGKGGVGK-STVTSLLGHGLAARTPYVNVGI 267 +EI+ K + +V +++ GKGGVGK STV S++G AA + + + G+ Sbjct: 25 LEILGKYKEEDVSSLTVLVMGKGGVGKSSTVNSVIGEKAAAVSTFQSEGL 74 >At5g05000.2 68418.m00530 translocate of chloroplast 34 (TOC34) / GTP-binding protein (OEP34) contains Pfam PF04548: AIG1 family;contains TIGRFAM TIGR00991: GTP-binding protein and TIGR00231: small GTP-binding protein domain; 99.7% identical to atToc34 protein (GI:11557975) [Arabidopsis thaliana]; similar to Chain A, Pea Toc34 - A Novel Gtpase Of The Chloroplast Protein Translocon (GI:1865556) [Pisum sativum]; almost identical to SP:Q38906 Translocase of chloroplast 34; identical to cDNA GTP-binding protein (OEP34) GI:1151243 Length = 313 Score = 32.3 bits (70), Expect = 0.32 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 2/50 (4%) Frame = +1 Query: 124 IEII-KNRLSNVKHKILVLSGKGGVGK-STVTSLLGHGLAARTPYVNVGI 267 +EI+ K + +V +++ GKGGVGK STV S++G AA + + + G+ Sbjct: 25 LEILGKYKEEDVSSLTVLVMGKGGVGKSSTVNSVIGEKAAAVSTFQSEGL 74 >At5g05000.1 68418.m00529 translocate of chloroplast 34 (TOC34) / GTP-binding protein (OEP34) contains Pfam PF04548: AIG1 family;contains TIGRFAM TIGR00991: GTP-binding protein and TIGR00231: small GTP-binding protein domain; 99.7% identical to atToc34 protein (GI:11557975) [Arabidopsis thaliana]; similar to Chain A, Pea Toc34 - A Novel Gtpase Of The Chloroplast Protein Translocon (GI:1865556) [Pisum sativum]; almost identical to SP:Q38906 Translocase of chloroplast 34; identical to cDNA GTP-binding protein (OEP34) GI:1151243 Length = 313 Score = 32.3 bits (70), Expect = 0.32 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 2/50 (4%) Frame = +1 Query: 124 IEII-KNRLSNVKHKILVLSGKGGVGK-STVTSLLGHGLAARTPYVNVGI 267 +EI+ K + +V +++ GKGGVGK STV S++G AA + + + G+ Sbjct: 25 LEILGKYKEEDVSSLTVLVMGKGGVGKSSTVNSVIGEKAAAVSTFQSEGL 74 >At1g02280.1 68414.m00169 GTP-binding protein (TOC33) identical to atToc33 protein (GI:11557973) [Arabidopsis thaliana]; Carboxyl-terminal end highly similar to GTP-binding protein SP:U43377, location of EST gb|AA394770 and gb|R30089; identical to cDNA for chloroplast atToc33 protein GI:11557972 Length = 297 Score = 31.5 bits (68), Expect = 0.56 Identities = 18/35 (51%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = +1 Query: 166 ILVLSGKGGVGK-STVTSLLGHGLAARTPYVNVGI 267 +LVL GKGGVGK STV SL+G + +P+ G+ Sbjct: 39 VLVL-GKGGVGKSSTVNSLIGEQVVRVSPFQAEGL 72 >At5g47250.1 68418.m05826 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 843 Score = 30.7 bits (66), Expect = 0.98 Identities = 19/80 (23%), Positives = 37/80 (46%) Frame = +1 Query: 115 DPAIEIIKNRLSNVKHKILVLSGKGGVGKSTVTSLLGHGLAARTPYVNVGILDADICGPS 294 D +E L ++++L + G GGVGK+T+ +L+ + + +V I Sbjct: 161 DTTLEKTWESLRKDENRMLGIFGMGGVGKTTLLTLINNKFVEVSDDYDVVIWVESSKDAD 220 Query: 295 QPRVLGVRGEQVHNSGSGWS 354 ++ GE++H + WS Sbjct: 221 VGKIQDAIGERLHICDNNWS 240 >At4g10710.1 68417.m01751 transcriptional regulator-related similar to chromatin-specific transcription elongation factor FACT 140 kDa subunit (GI:5499741) [Homo sapiens] Length = 1074 Score = 30.7 bits (66), Expect = 0.98 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = +1 Query: 484 WGELDYLLIDTPPGTSDEHLSSVQYLSSAGLTGAVVVTTPQEVALLDVRKEIQF-CEKVS 660 WG D L I TPP + D ++YL S+ L ++ + ++ +K+I F C + Sbjct: 50 WGSADALAIATPPASDD-----LRYLKSSALNIWLLGYEFPDTIMVFTKKQIHFLCSRNK 104 Query: 661 VPVLGVVE 684 +L VV+ Sbjct: 105 ASLLEVVK 112 >At3g54950.1 68416.m06092 patatin-related low similarity to patatin [GI:169500][Solanum tuberosum]; contains Patatin domain PF01734 Length = 488 Score = 30.7 bits (66), Expect = 0.98 Identities = 23/95 (24%), Positives = 43/95 (45%), Gaps = 5/95 (5%) Frame = +1 Query: 106 SRPDPAIEIIKNRLSNVKHKILVLS----GKGGVGKSTVTSLLGHGLAARTPYVNVGILD 273 S+P+PA ++ + N + KI +LS G G+ + L H L +++ N I D Sbjct: 78 SKPEPANSVVAGSIKNQRGKICILSIDGGGMRGILPGKALAYLEHALKSKSGDPNARIAD 137 Query: 274 -ADICGPSQPRVLGVRGEQVHNSGSGWSPVYVTEN 375 D+ S + G+ + S G P++ ++ Sbjct: 138 YFDVAAGS--GIGGIYTAMLFGSRDGNRPIFKADD 170 >At1g01910.2 68414.m00109 anion-transporting ATPase, putative similar to SP|O43681 Arsenical pump-driving ATPase (EC 3.6.3.16) (Arsenite-translocating ATPase) (Arsenical resistance ATPase) (Arsenite-transporting ATPase) (ARSA) (ASNA-I) {Homo sapiens}; contains Pfam profile PF02374: Anion-transporting ATPase Length = 353 Score = 30.7 bits (66), Expect = 0.98 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +1 Query: 133 IKNRLSNVKHKILVLSGKGGVGKSTVTSLLGHGLAA 240 ++N L K + + GKGGVGK+T +S+L LA+ Sbjct: 10 VQNILDQESLKWVFVGGKGGVGKTTCSSILAICLAS 45 >At1g01910.1 68414.m00108 anion-transporting ATPase, putative similar to SP|O43681 Arsenical pump-driving ATPase (EC 3.6.3.16) (Arsenite-translocating ATPase) (Arsenical resistance ATPase) (Arsenite-transporting ATPase) (ARSA) (ASNA-I) {Homo sapiens}; contains Pfam profile PF02374: Anion-transporting ATPase Length = 353 Score = 30.7 bits (66), Expect = 0.98 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +1 Query: 133 IKNRLSNVKHKILVLSGKGGVGKSTVTSLLGHGLAA 240 ++N L K + + GKGGVGK+T +S+L LA+ Sbjct: 10 VQNILDQESLKWVFVGGKGGVGKTTCSSILAICLAS 45 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 29.9 bits (64), Expect = 1.7 Identities = 23/67 (34%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = -3 Query: 499 SPAPPSPL-RLRTALSYHFSWDPSI*PRRLHCPAETRSTLAIDSPLHIQETSPSQSYVLA 323 SPA PSP + + +S+ S P+ P H PA T S +P H +PS S A Sbjct: 203 SPATPSPSPKSPSPVSHSPSHSPAHTPS--HSPAHTPSHSPAHAPSHSPAHAPSHSPAHA 260 Query: 322 PRGHRVH 302 P H Sbjct: 261 PSHSPAH 267 >At5g43470.2 68418.m05315 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Closest Col-0 homolog to RPP8 Length = 908 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/34 (29%), Positives = 23/34 (67%) Frame = +1 Query: 127 EIIKNRLSNVKHKILVLSGKGGVGKSTVTSLLGH 228 E++ + + N H+++ ++G GG+GK+T+ + H Sbjct: 174 ELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFH 207 >At5g43470.1 68418.m05314 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Closest Col-0 homolog to RPP8 Length = 908 Score = 29.9 bits (64), Expect = 1.7 Identities = 10/34 (29%), Positives = 23/34 (67%) Frame = +1 Query: 127 EIIKNRLSNVKHKILVLSGKGGVGKSTVTSLLGH 228 E++ + + N H+++ ++G GG+GK+T+ + H Sbjct: 174 ELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFH 207 >At5g27710.1 68418.m03324 expressed protein Length = 380 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 377 RFSVTYTGDQPEPELCTCSPRT 312 +F V + D+P+PE CSPRT Sbjct: 70 KFLVPFKSDKPKPEFGRCSPRT 91 >At3g10350.1 68416.m01241 anion-transporting ATPase family protein similar to SP|O43681 Arsenical pump-driving ATPase (EC 3.6.3.16) (Arsenite-translocating ATPase) (Arsenical resistance ATPase) (Arsenite-transporting ATPase) (ARSA) (ASNA-I) {Homo sapiens}; contains Pfam profile PF02374: Anion-transporting ATPase; contains non-consensus GA donor splice site at intron 5 Length = 411 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 112 PDPAIEIIKNRLSNVKHKILVLSGKGGVGKSTVTSLL 222 P I +S K K +L GKGGVGK++ + L Sbjct: 71 PTETISEFDEMVSGTKRKYYMLGGKGGVGKTSCAASL 107 >At5g25930.1 68418.m03081 leucine-rich repeat family protein / protein kinase family protein contains similarity to Swiss-Prot:P47735 receptor-like protein kinase 5 precursor [Arabidopsis thaliana]; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1005 Score = 28.7 bits (61), Expect = 4.0 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 Query: 174 TFREGGSGEEYSNFLAWTW 230 T REG +G+E++N W+W Sbjct: 892 TGREGNNGDEHTNLADWSW 910 >At2g16790.1 68415.m01925 shikimate kinase family protein similar to thermosensitive glucokinase from Escherichia coli [SP|P39208] [SP|P46859]; contains Pfam profile PF01202: shikimate kinase Length = 189 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 148 SNVKHKILVLSGKGGVGKSTVTSLLGHGLA 237 ++V K++ + G G GKST+ +LG L+ Sbjct: 5 NDVTGKVIAIMGVSGAGKSTIGKMLGKALS 34 >At5g60760.1 68418.m07623 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 738 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 130 IIKNRLSNVKHKILVL-SGKGGVGKSTVTSLLGHGLAART 246 I+ R+ K + VL G G GKST+++LLG L T Sbjct: 161 ILSCRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITT 200 >At4g02510.1 68417.m00343 chloroplast outer membrane protein, putative similar to chloroplast protein import component Toc159 [Pisum sativum] GI:8489806, chloroplast outer envelope protein 86 [Pisum sativum] GI:599958, GTP-binding protein [Pisum sativum] GI:576509 Length = 1503 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/26 (61%), Positives = 21/26 (80%), Gaps = 1/26 (3%) Frame = +1 Query: 166 ILVLSGKGGVGKS-TVTSLLGHGLAA 240 ILVL GK GVGKS T+ S+LG+ +A+ Sbjct: 858 ILVL-GKAGVGKSATINSILGNQIAS 882 >At3g16300.1 68416.m02057 integral membrane family protein contains TIGRFAM TIGR01569 : plant integral membrane protein TIGR01569; contains Pfam PF04535 : Domain of unknown function (DUF588); At2g38480, At1g45222 and others share this domain structure; distantly related to GP|14030504 salicylic acid-induced fragment 1 protein {Gossypium hirsutum} Length = 212 Score = 28.3 bits (60), Expect = 5.2 Identities = 20/77 (25%), Positives = 35/77 (45%) Frame = -3 Query: 391 STLAIDSPLHIQETSPSQSYVLAPRGHRVHGAGSDHIYLHPRSQHLHMEFVQRVHVQARK 212 ST+A+ + +ETS + Y + H V IYL S + + ++ + + Sbjct: 59 STVAVTLMVTARETSMTTLYGFEFQLHAVWSLSDSLIYLVVVSSATVLYSLIQLIISGTR 118 Query: 211 LLYSSPLPPSRKVQVFC 161 L+ SP+ P+R FC Sbjct: 119 LMRKSPVIPTRTQAWFC 135 >At2g43400.1 68415.m05394 electron transfer flavoprotein-ubiquinone oxidoreductase family protein contains Pfam profile: PF05187 Electron transfer flavoprotein-ubiquinone oxidoreductase Length = 633 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -2 Query: 473 LKNC-FIIPFFLGPLHMTASSALPSRNPIDISDRFSVTYTGD 351 LKN I+P T+SS P +P++ S+RF Y+ D Sbjct: 22 LKNQRLILPLLPSSKPFTSSSVSPPPSPLNASNRFGYPYSAD 63 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = -3 Query: 499 SPAPPSPLRLRTALSYHFSWDPSI*PRRLHCPAETRSTLAIDSPLHIQETSPSQSY 332 SP PP PL+ ALS S P PR + + + PLH + +P + Sbjct: 273 SPPPPPPLKKTAALSSSASKKPPPAPRGSSSGESSNGQVKL-KPLHWDKVNPDSDH 327 >At1g02530.1 68414.m00204 multidrug resistance P-glycoprotein, putative similar to multidrug-resistant protein CjMDR1 GI:14715462 from [Coptis japonica] Length = 1273 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +1 Query: 118 PAIEIIKNRLSNVKH-KILVLSGKGGVGKSTVTSLL 222 P I+I ++ ++ K + L G+ G GKSTV SLL Sbjct: 1040 PGIQIFRDLCLTIRAGKTVALVGESGSGKSTVISLL 1075 >At5g59120.1 68418.m07409 subtilase family protein contains similarity to prepro-cucumisin GI:807698 from [Cucumis melo]; non-consensus AA acceptor site at exon 6 Length = 732 Score = 27.9 bits (59), Expect = 6.9 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = +1 Query: 148 SNVKHKILVLSGKGGVGKSTVTSLLGHGLAARTPYVNVGIL 270 S VK KILV G GG+ V S+ GL RTP +V + Sbjct: 382 SRVKGKILVCGGPGGL--KIVESVGAVGLIYRTPKPDVAFI 420 >At5g40470.1 68418.m04908 expressed protein Length = 496 Score = 27.9 bits (59), Expect = 6.9 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 5/77 (6%) Frame = +1 Query: 382 LMSIGFLLGSADDAVIWRGPKKNGMIKQFLSEVD-WGELDYLLIDTPPGTSDEHLSSV-- 552 L+ + + S +I G K+G++ QF+S + L+ L + P +D+HL S+ Sbjct: 267 LLKVSEICESLKSLLIHDGGSKDGLV-QFMSNARCYDTLERLDLRLPMDLTDDHLVSLAA 325 Query: 553 --QYLSSAGLTGAVVVT 597 + LS+ LT + VT Sbjct: 326 NFKCLSTLRLTSCIFVT 342 >At4g31530.1 68417.m04477 expressed protein Length = 324 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 166 ILVLSGKGGVGKSTVTSLLGHGLAAR 243 +LV+ G GGVG+ V SLL + +R Sbjct: 76 VLVVGGTGGVGQLVVASLLKRNIRSR 101 >At3g45090.2 68416.m04862 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 698 Score = 27.9 bits (59), Expect = 6.9 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 130 IIKNRLSNVKHKILVL-SGKGGVGKSTVTSLLGHGLAART 246 I+ R+ K + VL G G GKST+++LLG L T Sbjct: 128 ILACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITT 167 >At3g45090.1 68416.m04863 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 717 Score = 27.9 bits (59), Expect = 6.9 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 130 IIKNRLSNVKHKILVL-SGKGGVGKSTVTSLLGHGLAART 246 I+ R+ K + VL G G GKST+++LLG L T Sbjct: 147 ILACRIRERKESVTVLLCGTSGCGKSTLSALLGSRLGITT 186 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +1 Query: 34 SEDAGKASACAGCPNQNLCASGEASRPDPAIEIIKNRLSNVKHKILVLSGKGG 192 S + G A CP+ + +G ASR E + N H +V SG GG Sbjct: 152 SPNTGVLPAGNICPSGRILKTGMASRTSSRTETLCTGTGNYGHGNVVRSGGGG 204 >At1g56520.1 68414.m06499 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 897 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 145 LSNVKHKILVLSGKGGVGKSTVTSLLGHG 231 L N KI+ +SG G+GKST+ + L HG Sbjct: 202 LKNDGVKIVGISGPAGIGKSTIATAL-HG 229 >At1g02520.1 68414.m00203 multidrug resistance P-glycoprotein, putative similar to multidrug-resistant protein CjMDR1 GI:14715462 from [Coptis japonica] Length = 1278 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 106 SRPDPAIEIIKNRLSNVKH-KILVLSGKGGVGKSTVTSLL 222 +RPD I+I ++ ++ K + L G+ G GKSTV SLL Sbjct: 1043 ARPD--IQIFRDLCLTIRAGKTVALVGESGSGKSTVISLL 1080 >At5g05400.1 68418.m00582 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 874 Score = 27.5 bits (58), Expect = 9.2 Identities = 18/76 (23%), Positives = 34/76 (44%) Frame = +1 Query: 124 IEIIKNRLSNVKHKILVLSGKGGVGKSTVTSLLGHGLAARTPYVNVGILDADICGPSQPR 303 +E N + V +L + G GGVGK+T+ S + + + ++ I P+ R Sbjct: 163 VESTWNSMMEVGVGLLGIYGMGGVGKTTLLSQINNKFRTVSNDFDIAIWVVVSKNPTVKR 222 Query: 304 VLGVRGEQVHNSGSGW 351 + G+++ GW Sbjct: 223 IQEDIGKRLDLYNEGW 238 >At3g54540.1 68416.m06035 ABC transporter family protein similar to ABC50 GI:10863747 from [Rattus norvegicus] Length = 723 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 127 EIIKNRLSNVKH-KILVLSGKGGVGKSTVTSLLGHGLAARTPYVNVGILDADICG 288 E++KN + H K L G G+GKST+ LL ++V +++ ++ G Sbjct: 176 ELLKNASVRISHGKRYGLIGPNGMGKSTLLKLLAWRKIPVPKNIDVLLVEQEVVG 230 >At3g24255.1 68416.m03045 expressed protein Length = 836 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 274 ADICGPSQPRVLGVRGEQVHNSGSGWS 354 +D+C P LG+R + N GS WS Sbjct: 209 SDVCTPKDEGGLGIRSLKEANKGSFWS 235 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 27.5 bits (58), Expect = 9.2 Identities = 21/67 (31%), Positives = 28/67 (41%), Gaps = 5/67 (7%) Frame = -2 Query: 365 TYTGDQPEPELCTCSPRTPST-----RGWLGPHISASKIPTFTYGVRAASPCPSKEVTVL 201 T +G P P + T P PS G P S++ P+ YG +P Sbjct: 59 TASGPPPAPPVGTMRPGQPSPFVSQIPGSRPPPPSSNSFPSPAYGPPGGAPFQR------ 112 Query: 200 FPTPPFP 180 FP+PPFP Sbjct: 113 FPSPPFP 119 >At3g05780.1 68416.m00649 Lon protease, putative similar to Lon protease homolog 2 SP:P93655 Length = 924 Score = 27.5 bits (58), Expect = 9.2 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +1 Query: 163 KILVLSGKGGVGKSTVTSLLGHGLAARTPYVNVGILD--ADICGPSQPRVLGVRGEQV 330 KI+ LSG GVGK+++ + L + +VG L A+I G Q V + G+ V Sbjct: 441 KIICLSGPPGVGKTSIGRSIARALDRKFFRFSVGGLSDVAEIKGHCQTYVGAMPGKMV 498 >At2g04040.1 68415.m00385 MATE efflux family protein contains Pfam profile: PF01554 uncharacterized membrane protein family Length = 476 Score = 27.5 bits (58), Expect = 9.2 Identities = 22/101 (21%), Positives = 43/101 (42%), Gaps = 8/101 (7%) Frame = -2 Query: 305 TRGWLGPHISASKIPTFTYGVRAASPCPSK----EVTVL----FPTPPFPESTSILCFTF 150 TRG++ +S F YG+ +A+ + E+ +L P P S +C T Sbjct: 237 TRGFVSRDFVSSIKQFFQYGIPSAAMICLEWWLFEILILCSGLLPNPKLETSVLSICLTI 296 Query: 149 DKRFFIISIAGSGREASPEAHRF*FGHPAHAEALPASSLCV 27 + ++IS + ++ ++ G+P A + LC+ Sbjct: 297 ETLHYVISAGVAAAVSTRVSNNLGAGNPQVARVSVLAGLCL 337 >At1g69295.1 68414.m07947 beta-1,3-glucanase-related low similarity to elicitor inducible beta-1,3-glucanase NtEIG-E76 [Nicotiana tabacum] GI:11071974 Length = 222 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 683 STTPSTGTDTFSQNCISLRTSSSATSCGVVTTTAPVS 573 + +PST + + NC++ +SS + G TT P S Sbjct: 88 AASPSTTPPSTASNCLTGSSSSGTPTTGTPTTGTPTS 124 >At1g67890.1 68414.m07752 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 765 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/52 (21%), Positives = 28/52 (53%) Frame = -2 Query: 701 IKSDMFSTTPSTGTDTFSQNCISLRTSSSATSCGVVTTTAPVSPALDRYCTD 546 +KS+ ++ + + + +++ ++SSA+SCG +++ +D C D Sbjct: 428 VKSESLASESNKPANNENMGSVNVNSASSASSCGSTSSSVMNKVDMDSDCLD 479 >At1g53350.1 68414.m06048 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 906 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = +1 Query: 127 EIIKNRLSNVKHKILVLSGKGGVGKSTVTSLLGH 228 E++ + + N +++ +SG GG+GK+T+ + H Sbjct: 172 ELVDHLVENDSVQVVSVSGMGGIGKTTLARQVFH 205 >At1g02020.2 68414.m00122 nitroreductase family protein contains Pfam PF00881: nitroreductase family protein profile; contains Prosite PS00343: Gram-positive cocci surface proteins 'anchoring' hexapeptide Length = 543 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +1 Query: 451 GMIKQFLSEVDWGELDYLLIDTPPGTSDEHLSSVQYLS 564 G K L E+++ D LL+ P GTS EHL ++ YL+ Sbjct: 300 GKGKAELPEIEFEHPDCLLLVFPNGTSREHL-NLDYLA 336 >At1g02020.1 68414.m00121 nitroreductase family protein contains Pfam PF00881: nitroreductase family protein profile; contains Prosite PS00343: Gram-positive cocci surface proteins 'anchoring' hexapeptide Length = 642 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +1 Query: 451 GMIKQFLSEVDWGELDYLLIDTPPGTSDEHLSSVQYLS 564 G K L E+++ D LL+ P GTS EHL ++ YL+ Sbjct: 300 GKGKAELPEIEFEHPDCLLLVFPNGTSREHL-NLDYLA 336 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.315 0.134 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,002,464 Number of Sequences: 28952 Number of extensions: 409692 Number of successful extensions: 1599 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 1515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1589 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits)
- SilkBase 1999-2023 -