BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_H09 (594 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) 31 0.93 SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 29 2.8 SB_26853| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) 28 6.5 SB_8164| Best HMM Match : rve (HMM E-Value=0.00069) 28 6.5 SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) 28 6.5 SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1778 Score = 31.1 bits (67), Expect = 0.70 Identities = 26/86 (30%), Positives = 37/86 (43%), Gaps = 2/86 (2%) Frame = +1 Query: 1 VRRQAGALTINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQMKLGAATAGLAY-DNVN 177 V+ + TIN + +K + GN + L A S N K G ++Y DN+N Sbjct: 662 VKEEDSKATINCIRNNNTYIKQSVEGNNSFSLDASSS---ENVRKEGDKDVVISYSDNMN 718 Query: 178 GHGATLT-KTHIPGFGDKMTAAGKVN 252 A T + IPG K + KVN Sbjct: 719 NSKAANTDQFGIPGSDSKTGSDSKVN 744 >SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 751 Score = 30.7 bits (66), Expect = 0.93 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = +1 Query: 184 GATLTKTHIPGFGDKMTAAGKVNLFHNNNHDFSAKAFATKNMPNIPQ-VPNFNTVGAG 354 G+T T IPG G + GK ++ N H S A P VP T GAG Sbjct: 322 GSTTKTTKIPGPGKIHISTGKPSITDNTKHKTSPSADGKGGKGEEPTIVPEMTTQGAG 379 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 338 TLSVPEWTTCSKIKLVHLRPPHTPMSLTATTTLWAE 445 TLS + T+ S ++ PPH+P + T TTT E Sbjct: 1748 TLSTLKTTSTSTSTTKYIPPPHSPPTTTTTTTTTPE 1783 >SB_26853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 28.3 bits (60), Expect = 4.9 Identities = 20/61 (32%), Positives = 26/61 (42%) Frame = +1 Query: 163 YDNVNGHGATLTKTHIPGFGDKMTAAGKVNLFHNNNHDFSAKAFATKNMPNIPQVPNFNT 342 Y NGH L ++ P T V F NN+DFS++ A N PN+ F Sbjct: 273 YTPTNGH-FQLDESVFPNSDSPDTRDQTVESFEINNNDFSSQENAQSN-PNLDNNDRFRP 330 Query: 343 V 345 V Sbjct: 331 V 331 >SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) Length = 474 Score = 27.9 bits (59), Expect = 6.5 Identities = 20/55 (36%), Positives = 24/55 (43%) Frame = +2 Query: 392 RPPHTPMSLTATTTLWAEN*IFSXXXXXXWTSTPVGRSSIHHSLSPRGNPAPVFL 556 RPP P S T+ TT A S T++PV SS + S PAP L Sbjct: 129 RPPPRPAS-TSLTTSAAFTSSTSSAASTSLTTSPVSTSSTSSAASTSLTPAPNIL 182 >SB_8164| Best HMM Match : rve (HMM E-Value=0.00069) Length = 1117 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -1 Query: 513 CIELLPTGVEVQRRGGRLEKIQFSAQRVVVAV 418 CI L+ T +V+RR +L + FSA+ V ++V Sbjct: 318 CIRLVNTRDDVKRRSEQLVNLAFSARHVGISV 349 >SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) Length = 685 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -2 Query: 128 WLVRSTEPRALSLWFSLPVMGTLTIAPEVPSELIV 24 W+V ++EP LS + ++ T +I P P I+ Sbjct: 472 WVVETSEPLQLSTTIMISIITTTSILPSFPPTAII 506 >SB_33008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1016 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 114 D*TKSTELVVFIASYGYLDHSTGGTIRVDSES 19 D +K+ E + IA++ L+H+ G I DSES Sbjct: 800 DLSKALEDIKNIAAFNVLEHAKSGEIESDSES 831 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.316 0.133 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,661,136 Number of Sequences: 59808 Number of extensions: 431471 Number of successful extensions: 935 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 935 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -