BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_H09 (594 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 25 0.74 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 2.3 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 2.3 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 23 2.3 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 3.0 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 5.2 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 6.9 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 6.9 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 6.9 L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein pro... 21 9.1 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.6 bits (51), Expect = 0.74 Identities = 12/19 (63%), Positives = 16/19 (84%), Gaps = 1/19 (5%) Frame = +2 Query: 380 LVHLRPPHTP-MSLTATTT 433 +VH PPH+P ++LTATTT Sbjct: 1362 IVHA-PPHSPQITLTATTT 1379 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 259 HNNNHDFSAKAFATKNMPNIPQVP 330 +NNN++ + K N+ NI Q+P Sbjct: 97 YNNNYNTNYKKLQYYNIINIEQIP 120 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 259 HNNNHDFSAKAFATKNMPNIPQVP 330 +NNN++ + K N+ NI Q+P Sbjct: 97 YNNNYNTNYKKLQYYNIINIEQIP 120 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 259 HNNNHDFSAKAFATKNMPNIPQVP 330 +NNN++ + K N+ NI Q+P Sbjct: 97 YNNNYNTNYKKLQYYNIINIEQIP 120 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 259 HNNNHDFSAKAFATKNMPNIPQVP 330 +NNN++ + K N+ NI Q+P Sbjct: 97 YNNNYNTNYKKLQYYNIINIEQIP 120 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 259 HNNNHDFSAKAFATKNMPNIPQVP 330 +NNN++ + K N+ NI Q+P Sbjct: 97 YNNNYNTNYKKLQYYNIINIEQIP 120 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 259 HNNNHDFSAKAFATKNMPNIPQVP 330 +NNN++ + K N+ NI Q+P Sbjct: 97 YNNNYNTNYKKLQYYNIINIEQIP 120 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 259 HNNNHDFSAKAFATKNMPNIPQVP 330 +NNN++ + K N+ NI Q+P Sbjct: 101 YNNNYNTNYKKLQYYNIINIEQIP 124 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 259 HNNNHDFSAKAFATKNMPNIPQVP 330 +NNN++ + K N+ NI Q+P Sbjct: 97 YNNNYNTNYKKLQYYNIINIEQIP 120 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.0 bits (47), Expect = 2.3 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +1 Query: 250 NLFHNNNHDFSAKAFATKNMPNIPQVP 330 N ++ NN++++ K + + NI Q+P Sbjct: 102 NKYNYNNNNYNKKLYYKNYIINIEQIP 128 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 267 QPRFQCQSIRH*KHAKYSSSSELQHCR 347 QP F+C+ + +Y S+ L H R Sbjct: 418 QPAFRCKPSQRFASGRYYSAYSLHHVR 444 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 5.2 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +1 Query: 250 NLFHNNNHD-FSAKAFATKNMPNIPQVP 330 N ++NNN++ ++ K + + NI Q+P Sbjct: 331 NNYNNNNYNNYNKKLYYKNYIINIEQIP 358 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = -2 Query: 533 HEDLMNGVSNFFQPALKSSDVVGV 462 ++DL++ + +P + +SDV+ V Sbjct: 33 YDDLLSNYNKLVRPVVNTSDVLRV 56 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = -2 Query: 533 HEDLMNGVSNFFQPALKSSDVVGV 462 ++DL++ + +P + +SDV+ V Sbjct: 33 YDDLLSNYNKLVRPVVNTSDVLRV 56 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/45 (22%), Positives = 17/45 (37%) Frame = +1 Query: 250 NLFHNNNHDFSAKAFATKNMPNIPQVPNFNTVGAGVDYMFKDKIG 384 +L N N DF + P++ P ++ G D +G Sbjct: 349 HLISNENRDFQTTPTVSVEQPHLFLYPEVSSTYTGFGIQSTDFVG 393 >L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein protein. Length = 74 Score = 21.0 bits (42), Expect = 9.1 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -1 Query: 366 HVVHSGTDSVEVRNLRNIWHVFSGE 292 H H V+V NLR V +GE Sbjct: 39 HCSHCDRQFVQVANLRRHLRVHTGE 63 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.316 0.133 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,598 Number of Sequences: 438 Number of extensions: 3915 Number of successful extensions: 18 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -