BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_H06 (675 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 28 1.4 SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi... 27 3.3 SPAC2F3.12c |||conserved eukaryotic protein|Schizosaccharomyces ... 26 5.7 SPAC22A12.10 |||diacylglycerol cholinephosphotranferase/ diacylg... 25 7.6 SPBC16E9.14c |||membrane transporter|Schizosaccharomyces pombe|c... 25 7.6 SPAC13C5.06c |mug121||sequence orphan|Schizosaccharomyces pombe|... 25 7.6 SPBC428.08c |clr4||histone H3 methyltransferase Clr4|Schizosacch... 25 10.0 SPAC3A11.09 |sod22||plasma membrane alkali metal cation/H+ antip... 25 10.0 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 27.9 bits (59), Expect = 1.4 Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +1 Query: 283 HDTPASGSTASLTTTIHHHPKQSHSEAW*FNSSDYQEHGTVRKN-EKHLPPGSSRGQDRR 459 H+T S +S + HHH + H+++ ++ H RK+ +HL SSR + Sbjct: 1292 HETSTSSRKSSKSGEHHHHHNEGHADS--SSTRTSLAHQDSRKSLHRHLSRSSSRASKKP 1349 Query: 460 QV 465 + Sbjct: 1350 SI 1351 >SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3071 Score = 26.6 bits (56), Expect = 3.3 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 479 NDPVGQLADCGEQGNTVTHKGHHPDLD-SDTVAYLWTA 589 ND + ++A GE+ T K HP L S + YLW++ Sbjct: 2280 NDFIAEIAPEGEEFLTYLRKHSHPMLKLSSSDCYLWSS 2317 >SPAC2F3.12c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 279 Score = 25.8 bits (54), Expect = 5.7 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 4/33 (12%) Frame = -3 Query: 442 LTSLEVDVSHFY----VRCHALDNHLN*ITRLH 356 L+S +V V HFY +RC +D+HL I ++H Sbjct: 151 LSSKKV-VIHFYHPDFIRCKIIDSHLEKIAKVH 182 >SPAC22A12.10 |||diacylglycerol cholinephosphotranferase/ diacylglycerol ethanolaminesphotranferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 386 Score = 25.4 bits (53), Expect = 7.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 88 LPSYYSVHTFTLYTGYYTRPTEG 156 + ++ HT TLY Y++ P EG Sbjct: 156 ISTWEEYHTGTLYLSYFSGPVEG 178 >SPBC16E9.14c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 386 Score = 25.4 bits (53), Expect = 7.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 139 TRPTEGKAGHLRYSRDHYYNVP 204 TRPT K H ++S H Y +P Sbjct: 44 TRPTHRKGHHHKHSLSHQYFLP 65 >SPAC13C5.06c |mug121||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 177 Score = 25.4 bits (53), Expect = 7.6 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 148 TEGKAGHLRYSRDHYYNVPVYDSGCDSS 231 T G AG + Y+ + +NVP Y + DS+ Sbjct: 19 TPGLAGVVNYAENSEWNVPKYGNVLDSN 46 >SPBC428.08c |clr4||histone H3 methyltransferase Clr4|Schizosaccharomyces pombe|chr 2|||Manual Length = 490 Score = 25.0 bits (52), Expect = 10.0 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 Query: 217 GCDSSDPRRCQC 252 GCD ++P RC+C Sbjct: 267 GCDLNNPSRCEC 278 >SPAC3A11.09 |sod22||plasma membrane alkali metal cation/H+ antiporter Sod22|Schizosaccharomyces pombe|chr 1|||Manual Length = 759 Score = 25.0 bits (52), Expect = 10.0 Identities = 17/53 (32%), Positives = 22/53 (41%), Gaps = 6/53 (11%) Frame = +1 Query: 280 EHDTPASGSTASLTTTIH------HHPKQSHSEAW*FNSSDYQEHGTVRKNEK 420 + D A ST SL H P+ H +A F S DY+ R NE+ Sbjct: 496 QEDEDADISTVSLPEAAHLREERAESPRGGHYDAEEFPSEDYESRQPRRSNEE 548 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,698,634 Number of Sequences: 5004 Number of extensions: 55881 Number of successful extensions: 135 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 135 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 309878492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -