BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_H06 (675 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 27 0.41 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 26 1.3 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 26 1.3 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 25 1.7 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 25 1.7 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 25 2.2 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 2.9 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 8.8 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 27.5 bits (58), Expect = 0.41 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 306 HRKPHHHHTPSPQAKP 353 H PHHHH S ++KP Sbjct: 1400 HPHPHHHHNGSGRSKP 1415 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 25.8 bits (54), Expect = 1.3 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +1 Query: 334 HHPKQSHSEAW*FNSSDYQEHGTVRKNEKH 423 H P++ + W FNSS+++ + V ++EK+ Sbjct: 274 HEPQEIRTCHWGFNSSNWRSYIHVAESEKN 303 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 25.8 bits (54), Expect = 1.3 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 484 PSGTTCRLRRTRQHRDSQRAPP 549 P+ T + RR +QH++ QR PP Sbjct: 84 PTTPTPQPRRMQQHQEKQRQPP 105 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.4 bits (53), Expect = 1.7 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 300 RLHRKPHHHHTPSPQAKPQ 356 +L PHH H P Q PQ Sbjct: 102 QLPHHPHHQHHPQQQPSPQ 120 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/20 (50%), Positives = 11/20 (55%), Gaps = 3/20 (15%) Frame = +3 Query: 306 HRKPHHH---HTPSPQAKPQ 356 H+ PHHH H P Q PQ Sbjct: 95 HQHPHHHQLPHHPHHQHHPQ 114 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.4 bits (53), Expect = 1.7 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 300 RLHRKPHHHHTPSPQAKPQ 356 +L PHH H P Q PQ Sbjct: 102 QLPHHPHHQHHPQQQPSPQ 120 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/20 (50%), Positives = 11/20 (55%), Gaps = 3/20 (15%) Frame = +3 Query: 306 HRKPHHH---HTPSPQAKPQ 356 H+ PHHH H P Q PQ Sbjct: 95 HQHPHHHQLPHHPHHQHHPQ 114 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 25.0 bits (52), Expect = 2.2 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = +1 Query: 283 HDTPASGST---ASLTTTIHHHPKQSH 354 H +P GST ASLT + H HP H Sbjct: 480 HVSPGMGSTVNGASLTHSHHAHPHHHH 506 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 24.6 bits (51), Expect = 2.9 Identities = 15/69 (21%), Positives = 28/69 (40%), Gaps = 3/69 (4%) Frame = +1 Query: 289 TPASGSTASLTTTIHHHPKQSHS---EAW*FNSSDYQEHGTVRKNEKHLPPGSSRGQDRR 459 TP S + HHH Q H+ A ++ ++ +++H PG++ Sbjct: 860 TPPSTHHQAAAVAAHHHHLQHHAAMVAAAAAAAASQEQQQRSSSSQQHRGPGAAAATGPP 919 Query: 460 QVDHQFERP 486 H+ E+P Sbjct: 920 PPTHRLEQP 928 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 437 RQGDKIVGKWTINSNDPVGQLADCGEQGNTVTHKGH 544 +Q +IVGK T+ S + ++ G GN T+ + Sbjct: 791 QQQQQIVGKNTLYSRNSSERMLPSGATGNNSTNSAY 826 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 718,508 Number of Sequences: 2352 Number of extensions: 15236 Number of successful extensions: 40 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -