BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_H05 (586 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_771| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.27) 29 2.8 SB_12433| Best HMM Match : RVT_1 (HMM E-Value=0.00019) 29 3.7 >SB_771| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.27) Length = 506 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 545 PPLHGKHDSMI*STNRQPIPKYXXXXXXXXXRLSWVHRSAVRLE 414 PP HG H +I T +P Y LSW+ + ++LE Sbjct: 290 PPYHGYH--LIMGTTLPWVPPYHGYRLIMSTTLSWLRQEKIQLE 331 >SB_12433| Best HMM Match : RVT_1 (HMM E-Value=0.00019) Length = 1234 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/21 (52%), Positives = 17/21 (80%), Gaps = 1/21 (4%) Frame = +1 Query: 37 HGTLIWNDTVFIV-KIKRRVL 96 HGT++W D V ++ K++RRVL Sbjct: 1017 HGTIMWGDRVVVLPKLRRRVL 1037 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,153,933 Number of Sequences: 59808 Number of extensions: 292269 Number of successful extensions: 434 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -