BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_H05 (586 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 5.5 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 5.5 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 23 7.3 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.4 bits (48), Expect = 5.5 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -2 Query: 576 LPPRGDREPLPSS 538 LPPR DR+ PSS Sbjct: 660 LPPRADRDSKPSS 672 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 5.5 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 410 QPLVELHFGAPKITYEPSPQLTFGTLVSAV 499 +PLV +G P+I P+ + TLV+ + Sbjct: 1091 RPLVSARYGTPRIGPAPAVEPAKKTLVATI 1120 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 23.0 bits (47), Expect = 7.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 310 SLHDGCYLISGFFSRVLGLIGSA 242 S+ GCYL + + ++G IGSA Sbjct: 312 SVTAGCYLYHAWEAILIGAIGSA 334 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 543,213 Number of Sequences: 2352 Number of extensions: 9488 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -