BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_H04 (535 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g14500.1 68415.m01623 F-box family protein contains F-box dom... 27 5.9 At2g32905.1 68415.m04034 hypothetical protein contains Pfam prof... 27 7.9 >At2g14500.1 68415.m01623 F-box family protein contains F-box domain Pfam:PF00646 Length = 347 Score = 27.5 bits (58), Expect = 5.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 439 ILIWFYRSSCHFLGFY 486 + +WF SC+FL FY Sbjct: 169 VAVWFLEDSCNFLAFY 184 >At2g32905.1 68415.m04034 hypothetical protein contains Pfam profile PF03754: Domain of unknown function (DUF313) Length = 205 Score = 27.1 bits (57), Expect = 7.9 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -2 Query: 288 PNLFLVLIKREETSHRLKEIPIKLCNESDFDNISSHFSIP 169 P L ++KREE S+ K I + ++D ++ + S+P Sbjct: 141 PEWLLKVMKREENSYNPKLISTRKLYKTDLASLQARLSVP 180 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,933,787 Number of Sequences: 28952 Number of extensions: 150441 Number of successful extensions: 270 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 270 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 984125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -