BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_G22 (476 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55961| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 29 1.5 SB_23713| Best HMM Match : Disintegrin (HMM E-Value=6.6e-05) 28 4.5 SB_33497| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_38369| Best HMM Match : E-MAP-115 (HMM E-Value=1.7) 27 6.0 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_21141| Best HMM Match : Collagen (HMM E-Value=0.01) 27 7.9 SB_55413| Best HMM Match : LRR_1 (HMM E-Value=0.00077) 27 7.9 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_55961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 5/45 (11%) Frame = -2 Query: 232 GTLQKHCGTSHSPD-----GGSISWTVGLSHDGSACCGQYNTECS 113 GT + G S+ P GG + W V + D +C GQ NT CS Sbjct: 32 GTNRLRNGNSYLPSHCNCPGGRVLWNVTKTEDSKSCIGQLNT-CS 75 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -3 Query: 246 GFERSVRCRSTAVRRTALMVGPSHGR*GCHMTALLVV 136 GF +S RC++TA + A + S G G M L+VV Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPGAMMAMLVVV 94 >SB_23713| Best HMM Match : Disintegrin (HMM E-Value=6.6e-05) Length = 1154 Score = 27.9 bits (59), Expect = 4.5 Identities = 21/69 (30%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = +1 Query: 55 WLR*SPSTVKEFL*ENARLVNTQCCTAHNKQSRHVTTLPSMRWTHHQGCA-TYRSASATY 231 +L + +T+ E R +NT T H + H L S R T H TYR + Sbjct: 720 YLNTNRTTIHALKGETYRYLNTNRTTIHALKGEHYHYLNSNRKTIHASKGETYRYLNTNR 779 Query: 232 RTFETLKPE 258 T LK E Sbjct: 780 TTIHALKGE 788 Score = 27.1 bits (57), Expect = 7.9 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = +1 Query: 55 WLR*SPSTVKEFL*ENARLVNTQCCTAHNKQSRHVTTLPSMRWT-HHQGCATYRSASATY 231 +L + +T+ E R +NT T H + + L S R T H TYR +A Sbjct: 522 YLNANRTTIHALKGETYRYLNTNRTTIHALKGEYYRYLNSNRTTIHALKGETYRYLNANR 581 Query: 232 RTFETLKPES 261 T LK E+ Sbjct: 582 TTIHALKGET 591 >SB_33497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 27.9 bits (59), Expect = 4.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 214 CGTSHSPDGGSISWTVGLSHD 152 CGTSH G ISW L D Sbjct: 230 CGTSHESTGNFISWLKSLPQD 250 >SB_38369| Best HMM Match : E-MAP-115 (HMM E-Value=1.7) Length = 412 Score = 27.5 bits (58), Expect = 6.0 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 81 QGIPIRKCPA-GEHSVLYCPQQAEPSCDNPTVHEMDPPSGL 200 QG P+R P G +L PQ+ P+ P PPSGL Sbjct: 162 QGGPLRMMPPPGMPPLLLRPQEFSPNIPPPRFGLTGPPSGL 202 >SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 246 GFERSVRCRSTAVRRTALMVGPSHGR*GCHM 154 GF +S RC++TA + A + S G GC + Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPGCKL 66 >SB_21141| Best HMM Match : Collagen (HMM E-Value=0.01) Length = 738 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 139 NKQSRHVTTLPSMRWTHHQGCATYRSASAT 228 N +H RWT H+G A Y ++ T Sbjct: 88 NAAHQHFQEAHQYRWTRHEGAAGYENSGLT 117 >SB_55413| Best HMM Match : LRR_1 (HMM E-Value=0.00077) Length = 359 Score = 27.1 bits (57), Expect = 7.9 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +1 Query: 145 QSRHVTTLPSMRWTHHQGCATYRSASATYRTFETLKPESASNCQNVKY 288 + R V +R GCA R + + +LK S SNC+ V Y Sbjct: 42 EGRSVRASSLLRQLAKGGCAARRLSWMLVKQCSSLKTLSLSNCEKVTY 89 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 27.1 bits (57), Expect = 7.9 Identities = 16/60 (26%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +3 Query: 96 RKCPAGEHSVLYCPQQAEPSCDNPTVHEMDPPSGLCDVP----QCFCNVPNVRNLKTGKC 263 R CP ++ + C C P PP +C+VP Q +C P N ++ C Sbjct: 952 RDCP---NNFMCCDSGCYKQCVKPNQVFTMPPFSICEVPMRSGQIYCVCPECDNTESPVC 1008 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,623,439 Number of Sequences: 59808 Number of extensions: 268392 Number of successful extensions: 884 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 989515521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -