BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_G20 (327 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC119.07 |ppk19||serine/threonine protein kinase Ppk19|Schizos... 25 3.8 SPCC132.01c ||SPCC1322.17c|DUF814 family protein|Schizosaccharom... 25 3.8 SPBC1709.12 |rid1||GTPase binding protein Rid1|Schizosaccharomyc... 25 3.8 SPAC25A8.03c ||SPAC3C7.15c|DUF185 protein|Schizosaccharomyces po... 24 5.1 SPCC126.03 |pus1|SPCC126.03, SPCC126.03|tRNA pseudouridylate syn... 24 5.1 SPCC576.06c |||tyrosine-tRNA ligase|Schizosaccharomyces pombe|ch... 24 6.7 SPAC2C4.13 |vma16||V-type ATPase subunit c''|Schizosaccharomyces... 24 6.7 SPAC6G9.12 |cfr1||Chs five related protein Cfr1|Schizosaccharomy... 24 6.7 SPCPB16A4.06c |||sequence orphan|Schizosaccharomyces pombe|chr 3... 24 6.7 SPAC26H5.07c |||seven transmembrane receptor-like protein|Schizo... 23 8.8 SPBC31E1.06 |bms1|SPBC800.01|GTP binding protein Bms1|Schizosacc... 23 8.8 >SPBC119.07 |ppk19||serine/threonine protein kinase Ppk19|Schizosaccharomyces pombe|chr 2|||Manual Length = 1706 Score = 24.6 bits (51), Expect = 3.8 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 138 NSRVRRQAGALTVNSDGTSGAMVKVPITGNENH-RLSALGSVDLT 269 NS V + G+ + +S T +PI ENH L++ GS ++ Sbjct: 1439 NSPVTKVPGSSSTSSSSTQPINSTIPINPLENHGMLNSFGSTTVS 1483 >SPCC132.01c ||SPCC1322.17c|DUF814 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1021 Score = 24.6 bits (51), Expect = 3.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 308 SQSSCSGSQLHLVSEIYGAKGTEPV 234 S +GS +H+VSE G KG++ + Sbjct: 754 STPDTTGSDIHIVSEKRGKKGSKVI 778 >SPBC1709.12 |rid1||GTPase binding protein Rid1|Schizosaccharomyces pombe|chr 2|||Manual Length = 367 Score = 24.6 bits (51), Expect = 3.8 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 173 CQLRRHLRCYGQGTYNWKR 229 C ++R L C Q TYN +R Sbjct: 186 CTVQRGLECLSQSTYNVER 204 >SPAC25A8.03c ||SPAC3C7.15c|DUF185 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 467 Score = 24.2 bits (50), Expect = 5.1 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 Query: 182 RRHLRCYGQGTYNWKRKSQAQCPWLR 259 + HL YG+ TYN + Q W + Sbjct: 174 KNHLEVYGRTTYNIVLHNSWQASWFK 199 >SPCC126.03 |pus1|SPCC126.03, SPCC126.03|tRNA pseudouridylate synthase Lsp1|Schizosaccharomyces pombe|chr 3|||Manual Length = 534 Score = 24.2 bits (50), Expect = 5.1 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +3 Query: 111 YEDQPEQWANSRVRRQAGALTVNSDGTSGAMVKVPITGN 227 YE PE + N +R A AL NS+ G+ V N Sbjct: 227 YEQDPEGFVNPYSKRGAAAL-ANSENNKGSEAGVSAKTN 264 >SPCC576.06c |||tyrosine-tRNA ligase|Schizosaccharomyces pombe|chr 3|||Manual Length = 445 Score = 23.8 bits (49), Expect = 6.7 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 16 RCSPSYSSYQFFWSASTAGTCSLKSLVTTL 105 + + SYS YQ+F SA C ++T L Sbjct: 259 KLTDSYSLYQYFISAPDDLACKCLDMLTLL 288 >SPAC2C4.13 |vma16||V-type ATPase subunit c''|Schizosaccharomyces pombe|chr 1|||Manual Length = 199 Score = 23.8 bits (49), Expect = 6.7 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +1 Query: 31 YSSYQFFWSASTAGTCSL 84 Y+ + FW T G C+L Sbjct: 126 YTGFALFWGGITVGLCNL 143 >SPAC6G9.12 |cfr1||Chs five related protein Cfr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 620 Score = 23.8 bits (49), Expect = 6.7 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +1 Query: 52 WSASTAGTCSLKSLVTTLNNMRISRSSGP 138 W T LKSL NN+R+ S P Sbjct: 99 WDPLQLSTARLKSLCLYRNNVRVLNISNP 127 >SPCPB16A4.06c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 126 Score = 23.8 bits (49), Expect = 6.7 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +2 Query: 134 GQLQGAPASGCTNCQLRRHLRCYGQGTYNWKRKSQAQCPWLRRS 265 GQL +P NC L+RH + + +S++ P RRS Sbjct: 21 GQLSTSPPRRWRNCTLQRHGSRASADEFCEQYRSRSHGPQGRRS 64 >SPAC26H5.07c |||seven transmembrane receptor-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 505 Score = 23.4 bits (48), Expect = 8.8 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 135 PTAPADPHIVQCS 97 PT+PA+PHI+ S Sbjct: 464 PTSPANPHIIHGS 476 >SPBC31E1.06 |bms1|SPBC800.01|GTP binding protein Bms1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1121 Score = 23.4 bits (48), Expect = 8.8 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 64 TAGTCSLKSLVTTLNNMRISRSSGPTPGCAGKR 162 T + +KSLV + IS+ +GP AGK+ Sbjct: 85 TGKSTLIKSLVRRYSKYTISQITGPITVVAGKK 117 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,363,260 Number of Sequences: 5004 Number of extensions: 24031 Number of successful extensions: 69 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 89857768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -