BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_G16 (468 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35197| Best HMM Match : SAP (HMM E-Value=3.2) 34 0.068 SB_43504| Best HMM Match : Urotensin_II (HMM E-Value=0.05) 31 0.48 SB_31769| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_12923| Best HMM Match : zf-C3HC4 (HMM E-Value=1.1) 29 1.5 SB_38537| Best HMM Match : VWA (HMM E-Value=0) 29 1.9 SB_33453| Best HMM Match : BRF1 (HMM E-Value=1.4) 29 1.9 SB_44424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_34539| Best HMM Match : SIR2 (HMM E-Value=1.7) 29 2.5 SB_3065| Best HMM Match : HD (HMM E-Value=0.018) 29 2.5 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 29 2.5 SB_58060| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_50057| Best HMM Match : NACHT (HMM E-Value=1.4e-08) 28 3.4 SB_42290| Best HMM Match : Band_41 (HMM E-Value=3.6e-09) 28 3.4 SB_32366| Best HMM Match : Kinesin (HMM E-Value=0) 27 5.9 SB_43987| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) 27 5.9 SB_31087| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-32) 27 7.7 SB_21046| Best HMM Match : DUF331 (HMM E-Value=3.2) 27 7.7 SB_17447| Best HMM Match : zf-B_box (HMM E-Value=0.04) 27 7.7 >SB_35197| Best HMM Match : SAP (HMM E-Value=3.2) Length = 323 Score = 33.9 bits (74), Expect = 0.068 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +2 Query: 170 SGHYSDQGQPQSYH*NPRHRAPPMFVFVLAVCMCTVL 280 S H+ Q Q Q + +PRHR PP+ + ++ + ++ Sbjct: 103 SHHHHQQQQQQQHRHHPRHRRPPLIIIIIVIIYIIII 139 >SB_43504| Best HMM Match : Urotensin_II (HMM E-Value=0.05) Length = 444 Score = 31.1 bits (67), Expect = 0.48 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 430 CILSYNNYKITYKSHEKFI*FNVQDCYCWYVPKYE 326 C+ Y Y TY + +++ + DCYC YV Y+ Sbjct: 56 CMNGYCRYVSTYDCYSRYV--STYDCYCRYVSTYD 88 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 418 YNNYKITYKSHEKFI*FNVQDCYCWYVPKYE 326 Y+ Y TY + +++ + DCYC YV Y+ Sbjct: 70 YSRYVSTYDCYCRYV--STYDCYCRYVSTYD 98 Score = 27.5 bits (58), Expect = 5.9 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -3 Query: 430 CILSYNNYKITYKSHEKFI*F-NVQDCYCWYVPKYELQLG 314 C+ Y Y TY + + + DCYC YV Y+ G Sbjct: 161 CMNGYCRYVSTYDCMNGYCRYVSTYDCYCRYVSTYDCMNG 200 Score = 27.5 bits (58), Expect = 5.9 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -3 Query: 430 CILSYNNYKITYKSHEKFI*F-NVQDCYCWYVPKYELQLG 314 C+ Y Y TY + + + DCYC YV Y+ G Sbjct: 311 CMNGYCRYVSTYDCMNGYCRYVSTYDCYCRYVSTYDCMNG 350 >SB_31769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 29.9 bits (64), Expect = 1.1 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -2 Query: 272 YTYTR-PAQKQT*EERDDVGFSGSFAVDLGHYSGPT*RAHQVSGIRTDRRDIHC 114 +T+ R P + T R VGF+ F V H+S H V G+ T + +HC Sbjct: 79 FTFHRHPVAQSTDSIRAKVGFNRGFHVWEIHWSTRQRGTHAVVGVATAKAPLHC 132 >SB_12923| Best HMM Match : zf-C3HC4 (HMM E-Value=1.1) Length = 166 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 144 PANLVCPSCRATIVTKVNRKATTKTHVIALLLCLF 248 P CP C+ IVT+ + K+ T+ + LC+F Sbjct: 42 PVYTTCPFCQEKIVTRTSFKSGKYTYWTSACLCIF 76 >SB_38537| Best HMM Match : VWA (HMM E-Value=0) Length = 1174 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 93 ITSFLITTMNIAPVGPNPANLVCPSCRATIVTKVNRKA 206 + SF T ++ + NLVCP+ R + +T++N K+ Sbjct: 14 VVSFYATLLSFSFAQAQTQNLVCPTVRTSALTQLNCKS 51 >SB_33453| Best HMM Match : BRF1 (HMM E-Value=1.4) Length = 412 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -3 Query: 367 NVQDCYCWYVPKYELQLGQ*WSAFWQESIQYGTHTHGQHKNKHRRS 230 +V+ C+C Y P Q GQ + Q HT Q +KH+RS Sbjct: 107 DVRRCFCRYAPPLAEQEGQLIETEATGAPQKHHHTLNQSHSKHKRS 152 >SB_44424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1350 Score = 28.7 bits (61), Expect = 2.5 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 109 IKNDVIAPIPETPLIINTAKFVDLDFYNKN*HNH 8 + D+ AP PE PL + F + + N+ NH Sbjct: 621 VPEDLFAPYPEVPLFSVYSSFTGVQYANRTNENH 654 >SB_34539| Best HMM Match : SIR2 (HMM E-Value=1.7) Length = 1384 Score = 28.7 bits (61), Expect = 2.5 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 109 IKNDVIAPIPETPLIINTAKFVDLDFYNKN*HNH 8 + D+ AP PE PL + F + + N+ NH Sbjct: 37 VPEDLFAPYPEVPLFSVYSSFTGVQYANRTNENH 70 >SB_3065| Best HMM Match : HD (HMM E-Value=0.018) Length = 270 Score = 28.7 bits (61), Expect = 2.5 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -2 Query: 227 DDVGFSGSFAVDLGHYSGPT*RAHQVSGIRTDRRDIHCGD*K*RNRTYPRNASNNKYSKI 48 DDV G+F D+GH G Q+ + TD+ DI G R+ +P + +N + + Sbjct: 52 DDV-ILGAFFHDIGHLIGFDQGLSQMGDVGTDKHDI-VGQTYLRDLGFPDSVTNMVWGHV 109 Query: 47 R*PRFL 30 R+L Sbjct: 110 EAKRYL 115 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 240 CLFLCWPCVCVPYCMDSCQNADHYCPNCNSYL 335 C+ C P VC P C D C Y PN ++++ Sbjct: 704 CIAPC-PQVCAPACSDICCGFGAYAPNPDTHV 734 >SB_58060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 863 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -3 Query: 157 TRLAGFGPTGAIFIVVIKNDVIAPIPETPLIINTAKFV 44 TR+ GF P AI + + + P E PL + T K++ Sbjct: 764 TRMTGFAPKNAIKLRRVPLEAEKPPLEVPLEVGTKKYI 801 >SB_50057| Best HMM Match : NACHT (HMM E-Value=1.4e-08) Length = 1555 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 223 SSRSSYVCFCAGRVYVYRTVWILARTLTITAPTATRIWGHTNNNSL 360 ++ +S+V C GR T++ + +T T TA + + NNN + Sbjct: 1494 NNNNSFVKLCQGRSTTTITIFTITKTPMTTITTALSRYVNNNNNDI 1539 >SB_42290| Best HMM Match : Band_41 (HMM E-Value=3.6e-09) Length = 474 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 258 PCVCVPYCMDSCQNADHYCPNCNSYLGTYQQ 350 PC V YC +C + +YCP C +++ Q+ Sbjct: 420 PCGHV-YCCQTCASNLYYCPLCKTFITFVQR 449 >SB_32366| Best HMM Match : Kinesin (HMM E-Value=0) Length = 1492 Score = 27.5 bits (58), Expect = 5.9 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -1 Query: 378 SYDLTYKTVIVGMSPNTSCSWGS-NGQRSGKNPYSTVHIHTASTK 247 +Y + KT + P T C W + NG+ SG+N ++ H H K Sbjct: 1402 NYPVEDKTWVRPDGP-TFCQWSTVNGKTSGENSATSPHFHEPPPK 1445 >SB_43987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 970 Score = 27.5 bits (58), Expect = 5.9 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -3 Query: 319 LGQ*WSAFWQESIQ-YGTHTHGQHKNKHRRSAMTW 218 LG W+ W S + Y TH + K RR A+ W Sbjct: 69 LGPRWTG-WLNSFELYADDTHASNATKQRRRALLW 102 >SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) Length = 501 Score = 27.5 bits (58), Expect = 5.9 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +3 Query: 219 HVIALLLCLFLCWPCVCVPYCMDSCQNADHYCPNCNSYLG 338 HV A+L+ L CW C C +D+ C +C G Sbjct: 393 HVDAMLVMLMRCWSCRCDGCHVDAMLVMSMRCWSCRCDAG 432 >SB_31087| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-32) Length = 1039 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 240 CLFLCWPCVCVPYCMDSCQNADHYCP 317 CL L W C + CMDS +H CP Sbjct: 960 CLPLTWLCDSITDCMDS--KDEHNCP 983 >SB_21046| Best HMM Match : DUF331 (HMM E-Value=3.2) Length = 245 Score = 27.1 bits (57), Expect = 7.7 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 454 TKLLLFKVCILSYNNYKITYKSH 386 TK+++F C S NNY+ Y+ + Sbjct: 53 TKIMVFNNCAKSMNNYRFNYQGN 75 >SB_17447| Best HMM Match : zf-B_box (HMM E-Value=0.04) Length = 1223 Score = 27.1 bits (57), Expect = 7.7 Identities = 23/70 (32%), Positives = 29/70 (41%), Gaps = 5/70 (7%) Frame = +3 Query: 42 STNFAVFIIRGVSGIGAITSF----LITTMNIAPVGPNPA-NLVCPSCRATIVTKVNRKA 206 ST I R +G+ +T+ L T N P G A N PS R +NR+ Sbjct: 852 STGVPTLINRTPTGLRTVTNAAPTGLQTVTNAIPTGLRTASNNTQPSLRTVTEGFLNRQQ 911 Query: 207 TTKTHVIALL 236 TTK LL Sbjct: 912 TTKKSTFTLL 921 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,261,943 Number of Sequences: 59808 Number of extensions: 334464 Number of successful extensions: 1004 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1001 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 969807871 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -