BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_G16 (468 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 25 1.3 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 25 1.3 AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 25 1.7 AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranfe... 24 2.3 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 24 3.0 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 23 4.0 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 22 9.3 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 22 9.3 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 22 9.3 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 22 9.3 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 22 9.3 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 25.0 bits (52), Expect = 1.3 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 231 LLLCLFLCWPCVCV 272 L+LCL + W C+C+ Sbjct: 250 LVLCLLVPWTCICL 263 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 25.0 bits (52), Expect = 1.3 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 231 LLLCLFLCWPCVCV 272 L+LCL + W C+C+ Sbjct: 250 LVLCLLVPWTCICL 263 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 24.6 bits (51), Expect = 1.7 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 240 CLFLCWPCVCVPYC 281 CL C P CVP+C Sbjct: 150 CLSKCSPTKCVPFC 163 >AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranferase d9 protein. Length = 216 Score = 24.2 bits (50), Expect = 2.3 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = +2 Query: 176 HYSDQGQPQSYH*NPRHRAPPMFVFVLAVCMCTVLYGFLPER 301 H D P NP+H P + V +A+C + +L E+ Sbjct: 34 HRKDYVNPAFKKINPQHTVPTLVVDGVAICEPGAILIYLAEQ 75 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 23.8 bits (49), Expect = 3.0 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 354 VIVGMSPNTSCSWGSNGQRSGKNPYSTVHIHTASTKTNIGGA 229 + V S + + S+GS+ G S+VH+HT T +G A Sbjct: 255 IYVDPSSSPTPSFGSDHGIGGVTS-SSVHLHTGGHSTVLGSA 295 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.4 bits (48), Expect = 4.0 Identities = 10/29 (34%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -3 Query: 301 AFWQESIQYGTHTHGQH-KNKHRRSAMTW 218 A W++ +GTHTH + ++ + S+ TW Sbjct: 949 ATWKQKELHGTHTHQLNLEHIDKVSSSTW 977 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 22.2 bits (45), Expect = 9.3 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +3 Query: 231 LLLCLFLCWPCVCVPYCMDS 290 L++CL +P + + YC S Sbjct: 215 LVMCLMYTFPLIVILYCYGS 234 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 22.2 bits (45), Expect = 9.3 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +3 Query: 144 PANLVCPSCRATIVTKVNRKATTK 215 P CP CRAT N + K Sbjct: 521 PGRFECPLCRATYTRSDNLRTHCK 544 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 22.2 bits (45), Expect = 9.3 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +3 Query: 231 LLLCLFLCWPCVCVPYCMDS 290 L++CL +P + + YC S Sbjct: 215 LVMCLMYTFPLIVILYCYGS 234 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 22.2 bits (45), Expect = 9.3 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = +3 Query: 297 NADHYCPNCNSYLGTYQQ*QSCTLNH 374 N D+ C C Y+G + C L + Sbjct: 484 NGDYVCGQCQCYVGWIGKTCECNLQN 509 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 22.2 bits (45), Expect = 9.3 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 264 VCVPYCMDSCQNADHYCPNCNSYLGT 341 VC P C D Q A+H C YL T Sbjct: 918 VC-PACGDENQTAEHTIFICGMYLLT 942 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 513,996 Number of Sequences: 2352 Number of extensions: 11285 Number of successful extensions: 17 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -