BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_G15 (424 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g23190.1 68416.m02924 lesion inducing protein-related similar... 31 0.43 At1g04120.1 68414.m00401 ABC transporter family protein Strong s... 27 5.2 At3g25700.1 68416.m03198 chloroplast nucleoid DNA-binding protei... 27 6.9 >At3g23190.1 68416.m02924 lesion inducing protein-related similar to ORF, able to induce HR-like lesions [Nicotiana tabacum] Length = 216 Score = 30.7 bits (66), Expect = 0.43 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 2/78 (2%) Frame = +2 Query: 14 LIVFCTYNLFTNVTMSEAFFDE--YDYYNFDHDKHIFTGHGGKQRTKREATEHTNHFDPS 187 L +F TY + + +A YD+YN D+D+ FT K +E E T D Sbjct: 79 LFIFNTYVGAALLLVYQAILSPILYDFYNRDYDRDHFTVFYTK---FKEFVEETTSAD-G 134 Query: 188 GHSRKIVTKLVNTENNKK 241 G + + T +VN E+ +K Sbjct: 135 GVAMSLYTSVVNEESRQK 152 >At1g04120.1 68414.m00401 ABC transporter family protein Strong similarity to MRP-like ABC transporter gb|U92650 from A. thaliana and canalicular multi-drug resistance protein gb|L49379 from Rattus norvegicus Length = 1514 Score = 27.1 bits (57), Expect = 5.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 395 AMDVPSISEQGSDPQPLRVSAI 330 AMD+PS S + SD P+R S + Sbjct: 852 AMDIPSPSSEDSDENPIRDSLV 873 >At3g25700.1 68416.m03198 chloroplast nucleoid DNA-binding protein-related contains weak similarity to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 452 Score = 26.6 bits (56), Expect = 6.9 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = -2 Query: 390 GCSVDL*AGQRPAASSGIRHNVLLSLGNSVI-FLLQAIVVFIHRYIYCLLDFLLFSVFTN 214 GC + +GQ + +S N ++ LG I F Q F +++ YCL+D+ L T+ Sbjct: 205 GCGFRI-SGQSVSGTSFNGANGVMGLGRGPISFASQLGRRFGNKFSYCLMDYTLSPPPTS 263 Query: 213 FVTI 202 ++ I Sbjct: 264 YLII 267 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,007,294 Number of Sequences: 28952 Number of extensions: 174777 Number of successful extensions: 434 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 655255392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -