BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_G13 (622 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 30 1.1 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 29 1.9 At2g02870.1 68415.m00237 kelch repeat-containing F-box family pr... 29 1.9 At4g28430.1 68417.m04069 reticulon family protein contains Pfam ... 29 3.3 At1g11020.1 68414.m01264 zinc finger (C3HC4-type RING finger) fa... 29 3.3 At5g45180.1 68418.m05546 flavin-containing monooxygenase family ... 28 4.3 At5g67280.1 68418.m08483 leucine-rich repeat transmembrane prote... 27 7.6 At4g18150.1 68417.m02697 hypothetical protein 27 7.6 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 267 PPPSPVHMSFPSSPPA 220 PPPSPVH S P PP+ Sbjct: 682 PPPSPVHYSSPPPPPS 697 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 267 PPPSPVHMSFPSSPP 223 PPPSP H S P SPP Sbjct: 770 PPPSPAHYSPPPSPP 784 >At2g02870.1 68415.m00237 kelch repeat-containing F-box family protein weak similarity to Kelch-like protein 5 (Swiss-Prot:Q96PQ7) [Homo sapiens]; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 467 Score = 29.5 bits (63), Expect = 1.9 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 1/77 (1%) Frame = +2 Query: 35 VFDDSKNCVANGWGKNRFGKDDEFAVVLKKIELDMVEHSRCNDLLRYTELGARYNLHSS- 211 VF S+ +N + +DD+ + K L++V R L+ Y+ SS Sbjct: 15 VFSSSRLSESNWSNSYMYPEDDDKLLGNGKRALEVVGEVRQTKSLKLMGFSIIYDSDSSD 74 Query: 212 FVCAGGEEGKDMCTGDG 262 + +GGEE D GDG Sbjct: 75 YSLSGGEEQADAAIGDG 91 >At4g28430.1 68417.m04069 reticulon family protein contains Pfam profile PF02453: Reticulon Length = 457 Score = 28.7 bits (61), Expect = 3.3 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 2/51 (3%) Frame = -2 Query: 306 SLYLLLLMGQASG--PPPSPVHMSFPSSPPAQTKELCRLYLAPSSVYLSRS 160 SL L+LL + + P PSPV +S PSS P +E+ L L+PS + SR+ Sbjct: 34 SLDLVLLSPKNNNGTPYPSPVSLSSPSS-PVTLREI--LLLSPSPLRKSRT 81 >At1g11020.1 68414.m01264 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 321 Score = 28.7 bits (61), Expect = 3.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -1 Query: 394 DPGAKGCQRCIYSWHVL 344 DP GCQ C Y W VL Sbjct: 220 DPRMAGCQNCCYGWGVL 236 >At5g45180.1 68418.m05546 flavin-containing monooxygenase family protein / FMO family protein low similarity to SP|P31513 Dimethylaniline monooxygenase [N-oxide forming] 3 (EC 1.14.13.8) (Hepatic flavin-containing monooxygenase 3) (FMO 3) {Homo sapiens}; contains Pfam profile PF00743: Flavin-binding monooxygenase-like Length = 453 Score = 28.3 bits (60), Expect = 4.3 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 219 APEGRREKTCARVMAVVHWLVP 284 A +G+ KTC V+ HW++P Sbjct: 222 ANQGKEGKTCTMVVRTPHWVIP 243 >At5g67280.1 68418.m08483 leucine-rich repeat transmembrane protein kinase, putative Length = 751 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -2 Query: 282 GQASGPPPSPVHMSFPSSPPA 220 G+A+ PPPSP P+SPPA Sbjct: 290 GEATSPPPSPT----PNSPPA 306 >At4g18150.1 68417.m02697 hypothetical protein Length = 762 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -3 Query: 161 HY--NGYAPPYPVQSSLVLPQIHHPYRNDSS 75 HY +GY PY Q+ + L +HH Y+ + Sbjct: 722 HYGGHGYVSPYHSQAVMSLEHLHHQYQQQQN 752 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,391,496 Number of Sequences: 28952 Number of extensions: 253985 Number of successful extensions: 1083 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1075 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -