BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_G11 (670 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 98 6e-31 SB_40632| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_32713| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_35065| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_18246| Best HMM Match : SRF-TF (HMM E-Value=3.3) 28 6.0 SB_53724| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 98.3 bits (234), Expect(2) = 6e-31 Identities = 46/70 (65%), Positives = 60/70 (85%) Frame = +3 Query: 141 REIELHNKKSIIIYVPMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHETR 320 +EI++ KK+III+VP+P+++AFQKIQ RLVRELEKKFSGKHVV V R+ILP+P+ ++R Sbjct: 52 KEIDVGGKKAIIIFVPVPQIRAFQKIQTRLVRELEKKFSGKHVVIVAQRRILPRPTRKSR 111 Query: 321 VAYKQKRPRS 350 KQKRPRS Sbjct: 112 -NQKQKRPRS 120 Score = 54.0 bits (124), Expect(2) = 6e-31 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +3 Query: 462 HLD*NQQTTIEHKVDTFQSVYEKLTGREVTFESP 563 HLD QQTTI+HK++TF +VY+KLTG++V FE P Sbjct: 121 HLDKTQQTTIDHKLETFSTVYKKLTGKDVVFEFP 154 Score = 44.8 bits (101), Expect = 6e-05 Identities = 25/46 (54%), Positives = 31/46 (67%) Frame = +2 Query: 5 STKILKAGAIEPDTFETSISQALVELETNSDLKAQSGGELYITKAK 142 S KI+K + FE ISQA++ELE NSD+KAQ ELYI+ AK Sbjct: 8 SAKIVKPQGETANEFEQGISQAILELEMNSDMKAQL-RELYISSAK 52 >SB_40632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +1 Query: 202 RHSKRSKSGLSVS*KRSSAVSMLCS 276 RH RS+S L + K+S AV++LCS Sbjct: 574 RHRSRSRSRLEIVSKKSPAVNVLCS 598 >SB_32713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +2 Query: 431 EARWLTTHQSASRLEPTDYY 490 E+R TTHQ +S PTDYY Sbjct: 152 ESRTSTTHQKSSLRSPTDYY 171 >SB_35065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -2 Query: 636 LELLLHVLQFDFYRKIASKFTSKVRGTR-KSLR 541 + L + VL F F + I KF SKV+ +R KSLR Sbjct: 310 ITLYVRVLSFSFAKDIIQKFKSKVKLSRAKSLR 342 >SB_18246| Best HMM Match : SRF-TF (HMM E-Value=3.3) Length = 598 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 11/53 (20%) Frame = +3 Query: 216 IQIRLVRELEKKFSGKH--------VVFVGDRKILPKPSH---ETRVAYKQKR 341 +++R++ EKK KH V+F +RK+L K SH E +V + Q+R Sbjct: 143 VEVRVIFTKEKKLLTKHSHDLLEVQVIFTQERKLLTKHSHDLLEVQVIFTQER 195 >SB_53724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1005 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 120 NCTLPRPREIELHNKKSIIIYVPMP 194 NC L +P E+ +HN +I+ Y +P Sbjct: 284 NCELTKPGELYVHNGVNIVGYTDLP 308 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,649,857 Number of Sequences: 59808 Number of extensions: 457759 Number of successful extensions: 1485 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1481 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -