BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_G07 (673 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 25 0.43 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 6.9 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 21 9.2 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 25.4 bits (53), Expect = 0.43 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 91 FDLNSSIYYNNWGSKC*YRLVSIKHFSRVSQV 186 F LN ++ NN +C YR + + S++SQV Sbjct: 148 FFLNFMLHCNNTTWRCLYRWIVLYTLSKMSQV 179 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.4 bits (43), Expect = 6.9 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 193 GVPTLEVYAPTLVYRRMPVWTIGQ 264 GVPTLE R PVW G+ Sbjct: 205 GVPTLEELGFDTEGRLPPVWQGGE 228 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.0 bits (42), Expect = 9.2 Identities = 5/12 (41%), Positives = 9/12 (75%) Frame = -2 Query: 216 IHLQCWNTVANL 181 +HL CWN+ ++ Sbjct: 367 VHLGCWNSTPSI 378 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,176 Number of Sequences: 336 Number of extensions: 3035 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -