BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_G07 (673 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0609 - 18929600-18929646,18929753-18929924,18930304-189304... 28 7.8 >09_04_0609 - 18929600-18929646,18929753-18929924,18930304-18930498, 18930691-18930801,18930885-18931097,18931643-18931720, 18931894-18932001,18932175-18932316,18932413-18933761, 18934492-18935121 Length = 1014 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 134 SADIVLCQLNISRGFLKFATVFQHWRCMHPLW 229 S+D L LNIS L + V Q W+ P+W Sbjct: 326 SSDFSLKNLNISPDILSSSYVMQQWQKNAPVW 357 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,631,672 Number of Sequences: 37544 Number of extensions: 291789 Number of successful extensions: 602 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -