BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I09A02NGRL0002_G07 (673 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 25 2.9 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 5.0 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = +3 Query: 246 CLDYWSICQDACVKQFANVRLPVRQSVGEKPVKVDL 353 CL W +C + N +P+R E+ + DL Sbjct: 406 CLACWGVCSTFVLLWLINKVVPIRMDPNEELLGADL 441 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 110 FIIIIGGVSADIVLCQLNISRG 175 FII++G DIV ++NIS+G Sbjct: 1244 FIIVLGSF-IDIVYSEVNISKG 1264 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 645,920 Number of Sequences: 2352 Number of extensions: 12684 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -